Align citrate (pro-3S)-lyase (EC 4.1.3.6) (characterized)
to candidate Ga0059261_0896 Ga0059261_0896 Citrate lyase beta subunit
Query= BRENDA::Q037K5 (292 letters) >FitnessBrowser__Korea:Ga0059261_0896 Length = 272 Score = 123 bits (309), Expect = 4e-33 Identities = 92/283 (32%), Positives = 140/283 (49%), Gaps = 25/283 (8%) Query: 6 RTMMFVPGANPGMLRDAPIYGADAIMFDLEDAVSLKEKDTARMLVYSALKTFDYSSVETV 65 RT +F+P +NP + A AD I+ DLEDAV +KD AR SA + Sbjct: 10 RTALFLPASNPRAIEKARTLAADMIILDLEDAVKAGDKDAAREAAQSAE---GFGDRLFG 66 Query: 66 VRVNALD-AGGDQDIEAMVLGGINVVRLPKTETAQDIIDVDAVITAVEEKYGIQNGTTHM 124 +RVNA D A +D+EA+ V +PK E A+ I+ + + Sbjct: 67 IRVNAEDSAHWIEDLEAVRKSAATHVIVPKVEKAETIVRAAF------------HSERPV 114 Query: 125 MAAIESAEGVLNAREIAQASS---RMIGIALGAEDYLTSQHTHRSTDGAELSFARNYILH 181 +A IE+A GV++A IA A+ M G+ G D S + ++ + I+ Sbjct: 115 LAMIETAAGVMHAGAIAGATGSGVEMAGLIAGTNDLAASLRLPPAAGRTQMQLSLQLIVL 174 Query: 182 AAREAGIAAIDTVYTQVDNEEGLRHETALIKQLGFDGKSVINPRQIPVINGVFAPALAEV 241 AAR A I +D V+ ++D+ +GL E A + LGFDGKS+I+P QI ++ F P+ AE+ Sbjct: 175 AARAAEIWVLDGVFNRLDDGDGLAAEAAEGRLLGFDGKSLIHPNQIDIVRAAFDPSPAEL 234 Query: 242 QKAREIVAGLKEAEAKGAGVVSVNGQMVDKPVVERAQYTIALA 284 AR ++A A G G +M++ VE+A+ +A A Sbjct: 235 DDARALIA------AAGGGAERYKDRMIEDMHVEQAKLLLARA 271 Lambda K H 0.316 0.132 0.355 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 176 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 272 Length adjustment: 26 Effective length of query: 266 Effective length of database: 246 Effective search space: 65436 Effective search space used: 65436 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory