Align ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized)
to candidate Ga0059261_2293 Ga0059261_2293 cell division ATP-binding protein FtsE
Query= reanno::pseudo3_N2E3:AO353_03040 (254 letters) >FitnessBrowser__Korea:Ga0059261_2293 Length = 235 Score = 125 bits (313), Expect = 1e-33 Identities = 76/224 (33%), Positives = 127/224 (56%), Gaps = 13/224 (5%) Query: 4 LEVQDLHKRYGSH-EVLKGVSLKAAAGDVISIIGSSGSGKSTFLRCINLLEQPHAGKILL 62 ++ +++ RYG+ E L VS +AG + G+SG+GK++ LR + L ++P G + L Sbjct: 5 VQFENVGLRYGTGAETLSDVSFTLSAGSFYFVTGASGAGKTSLLRLLYLAQRPTRGIVRL 64 Query: 63 NNEELKLVANKDGALKAADPKQLQRMRSRLSMVFQHFNLWSHMTAMENIMEAPVHVLGMS 122 E+ GAL K+L R R+ +VFQ F L H++A +N+ P+ V G+ Sbjct: 65 FGEDA-------GALPR---KRLPGFRRRIGVVFQDFRLLPHLSAYDNVA-LPLRVAGIP 113 Query: 123 KAEAREKAELYLAKVGVSHRKDAYPGHMSGGEQQRVAIARALAMEPEVMLFDEPTSALDP 182 +A+ +A VG+ R A P +SGGEQQR+AIARA+ PE+++ DEPT +DP Sbjct: 114 EADIEGPVREMIAWVGLKDRDSAKPPTLSGGEQQRIAIARAVITRPEILIADEPTGNVDP 173 Query: 183 ELVGDVLKVMQALAQEGRTMVVVTHEMGFAREVSN-QLVFLHKG 225 ++ +L + +L + G T+VV TH+ + + +++ + KG Sbjct: 174 DMAERLLHLFDSLNRLGTTVVVATHDFQLISRIPDARMMRIEKG 217 Lambda K H 0.317 0.131 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 121 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 235 Length adjustment: 24 Effective length of query: 230 Effective length of database: 211 Effective search space: 48530 Effective search space used: 48530 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory