GapMind for catabolism of small carbon sources

 

Aligments for a candidate for PRO3 in Sphingomonas koreensis DSMZ 15582

Align Pyrroline-5-carboxylate reductase; P5C reductase; P5CR; PCA reductase; EC 1.5.1.2 (characterized)
to candidate Ga0059261_3321 Ga0059261_3321 pyrroline-5-carboxylate reductase

Query= SwissProt::P22008
         (273 letters)



>lcl|FitnessBrowser__Korea:Ga0059261_3321 Ga0059261_3321
           pyrroline-5-carboxylate reductase
          Length = 258

 Score =  158 bits (399), Expect = 1e-43
 Identities = 107/266 (40%), Positives = 143/266 (53%), Gaps = 14/266 (5%)

Query: 6   IAFIGAGNMAASLIGGLRAQGVPAA-QIRASDPGAEQRAKIAGEF-AIDVVESNAEAVAD 63
           +  +G G M     GG  A+G   A ++   DP A +  +      ++D VE+  E    
Sbjct: 3   VLLVGCGRM-----GGAMARGWNGAHRVLVFDPMAAELPEGTERVDSLDDVEAGGEMA-- 55

Query: 64  ADVVVLSVKPQAMKAVCQALAPALKPEQLIVSIAAGIPCASLEAWLGQPRPVVRCMPNTP 123
              VVL+VKPQ   ++ ++L P  + + L VSI AGI    L   LG  R  VR MPNTP
Sbjct: 56  ---VVLAVKPQVFPSIGESLRPLARHDALFVSIMAGITLQGLSDALGSGR-TVRTMPNTP 111

Query: 124 ALLRQGASGLYANAQVSAAQCEQAGQLLSAVGIALWLDDEAQIDAVTAVSGSGPAYFFLL 183
           A + QG +   A   V         +LL   G  +W+D+EAQIDAVTAVSGSGPAYFF  
Sbjct: 112 AAIGQGITAAVAGRDVRMGDFATVNELLGPTGQVVWIDEEAQIDAVTAVSGSGPAYFFRF 171

Query: 184 MQAMTDAGEKLGLSRETASRLTLQTALGAAQMALSSEVEPAELRRRVTSPNGTTEAAIKS 243
            +A+  AG + GL  E A +L   T  GAA +A +   E AELRR+VTSP GTT A +  
Sbjct: 172 TEALARAGAEEGLPPELAMQLARATFTGAAALAGADPAELAELRRQVTSPGGTTAAGLGQ 231

Query: 244 F-QANGFEALVEQALNAASQRSAELA 268
               +  + LV + + AA+ RS ELA
Sbjct: 232 LDHDDAIDRLVRKVVEAAAARSRELA 257


Lambda     K      H
   0.315    0.127    0.348 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 186
Number of extensions: 7
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 273
Length of database: 258
Length adjustment: 25
Effective length of query: 248
Effective length of database: 233
Effective search space:    57784
Effective search space used:    57784
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 47 (22.7 bits)

Align candidate Ga0059261_3321 Ga0059261_3321 (pyrroline-5-carboxylate reductase)
to HMM TIGR00112 (proC: pyrroline-5-carboxylate reductase (EC 1.5.1.2))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR00112.hmm
# target sequence database:        /tmp/gapView.4810.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00112  [M=263]
Accession:   TIGR00112
Description: proC: pyrroline-5-carboxylate reductase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                 Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                 -----------
    1.3e-70  224.0   0.2    1.6e-70  223.8   0.2    1.0  1  lcl|FitnessBrowser__Korea:Ga0059261_3321  Ga0059261_3321 pyrroline-5-carbo


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Korea:Ga0059261_3321  Ga0059261_3321 pyrroline-5-carboxylate reductase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  223.8   0.2   1.6e-70   1.6e-70       2     263 .]       4     256 ..       3     256 .. 0.93

  Alignments for each domain:
  == domain 1  score: 223.8 bits;  conditional E-value: 1.6e-70
                                 TIGR00112   2 aiiGaGnmgeallsgllkkgakakkeilvierseeklaalakelgvevtsdaeeavkeadvvllavKPq 70 
                                                ++G+G+mg a+++g+  +     +++lv ++++++l +  +++    + d++ea  e+  v+lavKPq
  lcl|FitnessBrowser__Korea:Ga0059261_3321   4 LLVGCGRMGGAMARGWNGA-----HRVLVFDPMAAELPEGTERV---DSLDDVEAGGEM-AVVLAVKPQ 63 
                                               689************9886.....56899998888777776665...444556778777.89******* PP

                                 TIGR00112  71 dleevlaelkseektkeklliSilAGvtiekleqlleaekrvvRvmPNtaakvgagvtaiaassevsee 139
                                               +++++ ++l+   +++++l++Si+AG+t++ l+++l++  r+vR mPNt+a++g+g+ta++a+++v+  
  lcl|FitnessBrowser__Korea:Ga0059261_3321  64 VFPSIGESLRP-LARHDALFVSIMAGITLQGLSDALGS-GRTVRTMPNTPAAIGQGITAAVAGRDVRMG 130
                                               **********9.6669********************86.78**************************** PP

                                 TIGR00112 140 qkelveellkavGkvveve.eklldavtalsGSgPAfvflliealadagvklGLpreeakelaaqtlkG 207
                                               + ++v+ell  +G+vv+++ e+++davta+sGSgPA++f + eala+ag ++GLp e+a++la++t+ G
  lcl|FitnessBrowser__Korea:Ga0059261_3321 131 DFATVNELLGPTGQVVWIDeEAQIDAVTAVSGSGPAYFFRFTEALARAGAEEGLPPELAMQLARATFTG 199
                                               *******************99************************************************ PP

                                 TIGR00112 208 aaklleesgehpalLkdkVtsPgGtTiaglavLeekg.vrsavieaveaavkrseeL 263
                                               aa+l      + a+L+ +VtsPgGtT+agl  L +++ + + v + veaa++rs+eL
  lcl|FitnessBrowser__Korea:Ga0059261_3321 200 AAALAGADPAELAELRRQVTSPGGTTAAGLGQLDHDDaIDRLVRKVVEAAAARSREL 256
                                               *********************************99886999*************998 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (263 nodes)
Target sequences:                          1  (258 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00
# Mc/sec: 8.22
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory