Align Pyrroline-5-carboxylate reductase; P5C reductase; P5CR; EC 1.5.1.2; PCA reductase (uncharacterized)
to candidate Ga0059261_3808 Ga0059261_3808 Pyrroline-5-carboxylate reductase
Query= curated2:P74572 (267 letters) >FitnessBrowser__Korea:Ga0059261_3808 Length = 267 Score = 133 bits (334), Expect = 4e-36 Identities = 99/263 (37%), Positives = 142/263 (53%), Gaps = 11/263 (4%) Query: 5 LGIIGGGVMAEAILARLIAEKTYAPEEIIVGEPHGARRDYLQKTYQVRVSPDNQEAANVS 64 L +IG G MA A+L R +A T ++ V + +D + Q RV P + Sbjct: 7 LWLIGCGNMAGAMLRRWVAAGTVRGADVFV--LNRREQDLPEGVRQGRVLPQGA----LP 60 Query: 65 EVLLLAVKPQVLDRVLASLAGG-ANRPLVISILAGVSLQRIQKGFPDHAIIRAMPNTPAT 123 + ++L VKPQ +D V +AG A PL+ISILAG + F AI+RAMPN P Sbjct: 61 DAVMLGVKPQQIDEVAGQIAGRIAGVPLLISILAGADEAALAARFEARAIVRAMPNLPVE 120 Query: 124 VGAGMTAIAANKMVEPDQLAKAKAIFSAVGNVVEVPENLMDAVTG-VSGSGPAYVALMIE 182 +G G+ A+ + D A+A+A+ + +G +VE E + AV G ++GSGPA+V ++ Sbjct: 121 IGMGVVALHSEG-ASADARAQAQALMAPLG-LVEWVEAVHFAVVGALAGSGPAFVYRFVD 178 Query: 183 ALADGGVLAGLPRAIAQKLALQTVLGTAELIKETEEHPAQIKDKVTSPGGTTIAGVAVLE 242 ALA GG GLP A +LAL T G A L + + P + DKV SPGG+T AG+ VL+ Sbjct: 179 ALAAGGAALGLPAEQALRLALATAEGGALLAAGSTDTPGMLADKVASPGGSTRAGLNVLD 238 Query: 243 -KMGFRSAIIEAVRAAYRRSQEL 264 I E + A+ RR E+ Sbjct: 239 ADDALIRLITETLAASVRRDAEM 261 Lambda K H 0.316 0.133 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 203 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 267 Length adjustment: 25 Effective length of query: 242 Effective length of database: 242 Effective search space: 58564 Effective search space used: 58564 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory