Align ATP-binding cassette domain-containing protein; SubName: Full=Amino acid transporter; SubName: Full=Histidine ABC transporter ATP-binding protein; SubName: Full=Histidine transport system ATP-binding protein (characterized, see rationale)
to candidate Ga0059261_0341 Ga0059261_0341 ABC-type antimicrobial peptide transport system, ATPase component
Query= uniprot:A0A1N7U8S3 (276 letters) >FitnessBrowser__Korea:Ga0059261_0341 Length = 224 Score = 122 bits (305), Expect = 9e-33 Identities = 78/230 (33%), Positives = 127/230 (55%), Gaps = 16/230 (6%) Query: 27 LQVEGIHKRYGEH----EVLKGVSLNARQGDVISLIGASGSGKSTMLRCINFLEQPDAGV 82 LQ G+ + + + VL+G+ L QG++++L+G SGSGKST+L+ + LE G Sbjct: 6 LQTSGLKRTFSQGGADIHVLRGIDLTVGQGEIVALLGPSGSGKSTLLQAVGLLEGGFEGS 65 Query: 83 ITLDGISIEMRQGRAGTRAPHQDQLQNLRTRLAMVFQHFNLWSHMTVLENITMAPRRVLD 142 I + G+ + + A T R +L V+Q +L LEN+ + P+ + + Sbjct: 66 IRISGVEVGKLESHART--------VTRRDKLGFVYQFHHLLPDFNALENVEL-PQLIQN 116 Query: 143 VSAAEAEKRARMYLDKVGLPSRVADQYPAFLSGGQQQRVAIARALAMEPEIILFDEPTSA 202 + A+A R+ L +GL +R+ + P+ LSGG+QQRVA+ARALA P ++L DEPT Sbjct: 117 ATLADARARSEGLLTALGLGARLTHR-PSQLSGGEQQRVAVARALANRPALVLADEPTGN 175 Query: 203 LDPELVGEVL-KVIQTLAEEGRTMLMVTHEMGFARQVSSQVLFLHQGRVE 251 LD VL + ++ + EG L+ TH A ++ +V+ LH+G +E Sbjct: 176 LDEHTADIVLAEFLRLVRGEGAAALIATHNERLAAKM-DRVVRLHEGVLE 224 Lambda K H 0.319 0.133 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 154 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 224 Length adjustment: 24 Effective length of query: 252 Effective length of database: 200 Effective search space: 50400 Effective search space used: 50400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory