Align succinyl-CoA-glutarate CoA-transferase (EC 2.8.3.13) (characterized)
to candidate Ga0059261_0564 Ga0059261_0564 Predicted acyl-CoA transferases/carnitine dehydratase
Query= reanno::pseudo5_N2C3_1:AO356_10845 (406 letters) >FitnessBrowser__Korea:Ga0059261_0564 Length = 390 Score = 189 bits (480), Expect = 1e-52 Identities = 132/379 (34%), Positives = 191/379 (50%), Gaps = 18/379 (4%) Query: 2 GALSHLRVLDLSRVLAGPWAGQILADLGADVIKVERPGNGDDTRAWGPPFLKDARGENTT 61 G LS +RVLDLS +AGP+ +LAD GADVIKVE PG GD+ R + P L GEN Sbjct: 17 GPLSGIRVLDLSAYIAGPYGCSLLADQGADVIKVEPPG-GDNLRQY-PSTLA---GENRA 71 Query: 62 EAAYYLSANRNKQSVTIDFTRPEGQRLVRELAAKSDILIENFKVGGLAAYGLDYDSLKAI 121 +L NR+KQ V +D + + ++ +LA ++D+L+ NF+ G G+D+ +L A Sbjct: 72 ----FLGVNRSKQGVVLDLKQDGERAVLLDLADQADVLVHNFRPGVPERLGIDHAALSAR 127 Query: 122 NPQLIYCSITGFGQTGPYAKRAGYDFMIQGLGGLMSLTGRPEGDEGAGPVKVGVALTDIL 181 NP+LIYC++TG+G+ GP +AGYD ++Q + G+ L G P G + G + D Sbjct: 128 NPRLIYCAVTGYGEEGPLRAKAGYDQVLQAMTGMCVLQGPP----GTPEITYG-SPVDYY 182 Query: 182 TGLYSTAAILAALAHRDHVGGGQHIDMALLDVQVACLANQAMNYLTTGNAPKRLGNAHPN 241 A + +AL R+ G GQ++ ++LL + A A G P + Sbjct: 183 AAALVAAGVASALYERERSGVGQYVGVSLL--RSALTMQSARLIRAEGEDPGISRDMRSG 240 Query: 242 IVPYQDFPTADGDFILTVGNDGQFRKFAEVAGQPQWADDPRFATNKVRVANRAVLIPLIR 301 + PTA G L+ +R E G +D RF T K R A+ +IP +R Sbjct: 241 GITGL-HPTALGHLYLSANTPHFWRALCERTGLADLLEDSRFDTVKGRAAHADEIIPRLR 299 Query: 302 QATVFKTTAEWVTQLEQAGVPCGPINDLAQVFADPQVQARGLAMELPHLLAGKVPQVASP 361 A + +T AEW L A VPC + +F D QV A + ++PH + G VA Sbjct: 300 AALMERTAAEWEASLGDA-VPCSVARSIDDMFDDAQVAAEAMLSDIPHPVLGSYRGVARA 358 Query: 362 IRLSETPVEYRNAPPLLGE 380 I+ TP PLL E Sbjct: 359 IKFGRTPGPDPFKAPLLDE 377 Lambda K H 0.319 0.137 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 486 Number of extensions: 26 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 390 Length adjustment: 31 Effective length of query: 375 Effective length of database: 359 Effective search space: 134625 Effective search space used: 134625 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory