GapMind for catabolism of small carbon sources

 

Aligments for a candidate for ackA in Sphingomonas koreensis DSMZ 15582

Align Formate-dependent phosphoribosylglycinamide formyltransferase; 5'-phosphoribosylglycinamide transformylase 2; Formate-dependent GAR transformylase; GAR transformylase 2; GART 2; Non-folate glycinamide ribonucleotide transformylase; Phosphoribosylglycinamide formyltransferase 2; EC 2.1.2.- (characterized)
to candidate Ga0059261_3309 Ga0059261_3309 formate-dependent phosphoribosylglycinamide formyltransferase (EC 6.3.4.-)

Query= SwissProt::P33221
         (392 letters)



>lcl|FitnessBrowser__Korea:Ga0059261_3309 Ga0059261_3309
           formate-dependent phosphoribosylglycinamide
           formyltransferase (EC 6.3.4.-)
          Length = 388

 Score =  401 bits (1030), Expect = e-116
 Identities = 212/380 (55%), Positives = 263/380 (69%), Gaps = 3/380 (0%)

Query: 14  RVMLLGSGELGKEVAIECQRLGVEVIAVDRYADAPAMHVAHRSHVINMLDGDALRRVVEL 73
           +++LLGSGELG+E  I  +RLG +VIA D YA+APAM VA    V +MLDG+ALR  +  
Sbjct: 6   KILLLGSGELGREFVISAKRLGAQVIACDSYANAPAMQVADGHEVFSMLDGEALRAAIAK 65

Query: 74  EKPHYIVPEIEAIATDMLIQLEEEGLNVVPCARATKLTMNREGIRRLAAEELQLPTSTYR 133
             P Y+VPE+EAI T++L  +E EG+ VVP ARA ++TMNR+GIR +AA EL L TS YR
Sbjct: 66  HAPDYVVPEVEAIRTEVLADVEAEGVTVVPSARAAQMTMNRDGIREVAAVELGLRTSRYR 125

Query: 134 FADSESLFREAVADIGYPCIVKPVMSSSGKGQTFIRSAEQLAQAWKYAQQGGRAGAGRVI 193
           +A+S           G PC++KPVMSSSGKGQ+ +R A  L  AW YA    R    RVI
Sbjct: 126 YAESLEEVLAGAEHTGLPCVIKPVMSSSGKGQSTVREASALEAAWDYAVANMRGDRARVI 185

Query: 194 VEGVVKFDFEITLLTVSAVDGVHFCAPVGHRQEDGDYRESWQPQQMSPLALERAQEIARK 253
           VE  V FD+EITLLTV +  GV FC P+GHRQE GDY+ESWQP  MS  A+  AQ++ARK
Sbjct: 186 VEEFVDFDYEITLLTVRSRAGVSFCPPIGHRQERGDYQESWQPAAMSAQAIADAQDMARK 245

Query: 254 VVLALGGYGLFGVELFVCGDEVIFSEVSPRPHDTGMVTLISQDLSEFALHVRAFLGLPVG 313
           VV  LGGYG+FGVE FV G+EVIFSE+SPRPHDTGMVTLISQ+LSEF LH RA LGLPV 
Sbjct: 246 VVDDLGGYGIFGVEFFVKGEEVIFSELSPRPHDTGMVTLISQNLSEFDLHARAVLGLPVP 305

Query: 314 GIRQYGPAASAVILPQLTSQNVTFDNVQNAV---GADLQIRLFGKPEIDGSRRLGVALAT 370
            +R YGP+ASAVIL     +   ++ V  A+   G ++ +R+F KP     RR+GVALA 
Sbjct: 306 EVRLYGPSASAVILADRDGEAPGYEGVAEALAVPGGEIDLRIFAKPTTRPYRRMGVALAL 365

Query: 371 AESVVDAIERAKHAAGQVKV 390
           A     A   A  AAG+V++
Sbjct: 366 AGDTGAARTLAAEAAGKVRI 385


Lambda     K      H
   0.320    0.136    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 442
Number of extensions: 16
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 392
Length of database: 388
Length adjustment: 31
Effective length of query: 361
Effective length of database: 357
Effective search space:   128877
Effective search space used:   128877
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory