GapMind for catabolism of small carbon sources

 

Aligments for a candidate for adh in Sphingomonas koreensis DSMZ 15582

Align aldehyde dehydrogenase (NAD+) (EC 1.2.1.3) (characterized)
to candidate Ga0059261_1495 Ga0059261_1495 succinylglutamic semialdehyde dehydrogenase (EC 1.2.1.71)

Query= BRENDA::P76217
         (492 letters)



>lcl|FitnessBrowser__Korea:Ga0059261_1495 Ga0059261_1495
           succinylglutamic semialdehyde dehydrogenase (EC
           1.2.1.71)
          Length = 480

 Score =  432 bits (1112), Expect = e-125
 Identities = 228/460 (49%), Positives = 298/460 (64%), Gaps = 5/460 (1%)

Query: 14  GASRVKRNPVSGEVLWQGNDADAAQVEQACRAARAAFPRWARLSFAERHAVVERFAALLE 73
           G+  +   P +G VLW+    D   V+    AARA++  WA      R   + RFA ++ 
Sbjct: 12  GSEIISTEPATGAVLWRRPIGD---VDAEVAAARASWADWAARPLTYRIEALRRFANVVR 68

Query: 74  SNKAELTAIIARETGKPRWEAATEVTAMINKIAISIKAYHVRTGEQRSEMP-DGAASLRH 132
                 T +IARETGKP WEA TEV  +I K+ IS+ A+  RTG++R E P +   +LRH
Sbjct: 69  QKSEAFTDLIARETGKPLWEARTEVETVIAKVDISVTAFSERTGQRRIEAPMNTRLALRH 128

Query: 133 RPHGVLAVFGPYNFPGHLPNGHIVPALLAGNTIIFKPSELTPWSGEAVMRLWQQAGLPPG 192
           +PHGVLAV GPYNFP HLPNGHIVPALLAGN ++FKPSE TP +G  ++  +  AG+P G
Sbjct: 129 KPHGVLAVLGPYNFPAHLPNGHIVPALLAGNAVVFKPSEKTPATGAFLVECYHAAGIPEG 188

Query: 193 VLNLVQGGRETGQALSALEDLDGLLFTGSANTGYQLHRQLSGQPEKILALEMGGNNPLII 252
            + L+ GG + G+AL+  + +DGLLFTGSA TG  L+R  + +PEKILALEMGGNNP+++
Sbjct: 189 CIRLLIGGPDEGKALAGHDGIDGLLFTGSARTGIALNRAFAAKPEKILALEMGGNNPILV 248

Query: 253 DEVADIDAAVHLTIQSAFVTAGQRCTCARRLLLKSGAQGDAFLARLVAVSQRLTPGNWDD 312
               DI +A  L IQSAF +AGQRCT ARRL++      D  L  +  +  RL  G    
Sbjct: 249 WSTPDIYSAAVLVIQSAFTSAGQRCTAARRLIVDEKLY-DPLLEEVNKLIGRLIVGEPHA 307

Query: 313 EPQPFIGGLISEQAAQQVVTAWQQLEAMGGRPLLAPRLLQAGTSLLTPGIIEMTGVAGVP 372
           +P PF+G +I    A  +  ++ +L  MGGRPL        G   LTP +I+MT     P
Sbjct: 308 DPAPFMGPVIDNDTADLLTESFLELSFMGGRPLRHMERPVDGRPFLTPAMIDMTDAKEKP 367

Query: 373 DEEVFGPLLRVWRYDTFDEAIRMANNTRFGLSCGLVSPEREKFDQLLLEARAGIVNWNKP 432
           D E+FGP+L+V R  TF+EAI  ANNTR+GLS  LVS + + +DQ     RAGIVNWN+P
Sbjct: 368 DVELFGPILQVIRARTFEEAIAEANNTRYGLSASLVSQDPKLYDQFWANIRAGIVNWNRP 427

Query: 433 LTGAASTAPFGGIGASGNHRPSAWYAADYCAWPMASLESD 472
             GA+S APFGGIG SGNHRPSA+YAADYCA+P+ S E++
Sbjct: 428 TNGASSAAPFGGIGWSGNHRPSAFYAADYCAYPVVSSEAE 467


Lambda     K      H
   0.318    0.134    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 691
Number of extensions: 38
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 492
Length of database: 480
Length adjustment: 34
Effective length of query: 458
Effective length of database: 446
Effective search space:   204268
Effective search space used:   204268
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory