GapMind for catabolism of small carbon sources

 

Aligments for a candidate for adh in Sphingomonas koreensis DSMZ 15582

Align Putative aldehyde dehydrogenase SSP0762; EC 1.2.1.3 (uncharacterized)
to candidate Ga0059261_3374 Ga0059261_3374 NAD-dependent aldehyde dehydrogenases

Query= curated2:Q49Z69
         (475 letters)



>lcl|FitnessBrowser__Korea:Ga0059261_3374 Ga0059261_3374
           NAD-dependent aldehyde dehydrogenases
          Length = 474

 Score =  450 bits (1158), Expect = e-131
 Identities = 235/472 (49%), Positives = 306/472 (64%), Gaps = 1/472 (0%)

Query: 1   MRNFTKQYINGEWVESTSGETLEVINPATEEVAGTIAKGNKEDVEKAVEAADNVYLEFRH 60
           MR++ K YI GEWVES  G   +VINPATE     I  G++ D +KAV AA   +  F  
Sbjct: 1   MRSYLKHYIGGEWVESEGGTRHDVINPATEAPVTEITLGSEADADKAVAAAKAAFDSFSR 60

Query: 61  TSVKERQDLLDQIVQEYKNRKEDLIQAITDELGAPLSVAENVHYQMGLDHFEAARDALND 120
           TSV ER  LL+ I+ EYKNR  DL  AI  E+GAP+S+A+      G+ H  +  +AL  
Sbjct: 61  TSVDERIALLEAILAEYKNRAGDLADAIAAEMGAPISLAKTAQVGSGIGHLMSTINALKA 120

Query: 121 FQFEERRGDDLVVKEAIGVSGLITPWNFPTNQTSLKLAAAFAAGSPVVFKPSEETPFAAI 180
           F+F E+ G  LVV E IGV  LITPWN+P NQ   K+A A AAG+ +V KPSEE P +A 
Sbjct: 121 FEFSEQIGQSLVVHEPIGVVALITPWNWPLNQIVAKVAPALAAGNTMVLKPSEEAPGSAA 180

Query: 181 ILAEIFDKVGVPKGVFNLVNGDGQGVGNPLSEHPKVRMMSFTGSGPTGSSIMKKAAEDFK 240
           I AEI DK GVP GVFNLV GDG  VG  LS H  V M+SFTGS   G  + K AAE  K
Sbjct: 181 IFAEIMDKAGVPAGVFNLVQGDGPIVGTALSRHRDVDMVSFTGSTRAGIQVAKNAAETVK 240

Query: 241 KVSLELGGKSPYIILDDADIDGAASAAANKVVFNTGQVCTAGTRTIVPASIKEDFLTAVK 300
           +V  ELGGKSP +IL  AD+  A       VV N+GQ C A  R +V  S   +      
Sbjct: 241 RVHQELGGKSPNVILPGADLSRAVQVGLFSVVMNSGQSCIAPARMLVHESQAAEAAQIAS 300

Query: 301 EKFSQVKVGNPREEGTQVGPIISKKQFDQVQAYIDKGIEEGAELLYGGPGKPEGLDKGYF 360
                V+ G+P +EG  +GP+++K Q++++Q  I KG+EEGA+L  GGPG+P+G++ GYF
Sbjct: 301 GLMKAVETGDPAQEGRHIGPVVNKAQWEKIQGLIRKGMEEGAKLETGGPGRPDGIETGYF 360

Query: 361 ARPTIFNNVDNSMTIAQEEIFGPVMSVITYNDLDEAIKIANDTKYGLAGYVYGSDKDTLH 420
            +PT+F+ V N MTIA+EEIFGPV+++I Y D +EA++IANDT YGL+  ++GS ++ + 
Sbjct: 361 VKPTLFSGVRNDMTIAREEIFGPVITIIPYRDEEEAVRIANDTDYGLSAVLFGSPEE-VK 419

Query: 421 KVARSIEAGTVEINEAGRKPDLPFGGYKQSGLGREWGDYGIEEFLEVKSIAG 472
           +VA  + AG V IN     P LPFGGYKQSG GRE G +G+ EF+EVK++ G
Sbjct: 420 RVAPRLRAGMVYINGGQPDPSLPFGGYKQSGNGREHGKFGLAEFMEVKAMVG 471


Lambda     K      H
   0.313    0.134    0.380 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 609
Number of extensions: 28
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 475
Length of database: 474
Length adjustment: 33
Effective length of query: 442
Effective length of database: 441
Effective search space:   194922
Effective search space used:   194922
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory