Align 2-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase (Catechol pathway) protein; EC 4.2.1.80 (characterized, see rationale)
to candidate Ga0059261_0508 Ga0059261_0508 2-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase (catechol pathway)
Query= uniprot:D8INW0 (281 letters) >FitnessBrowser__Korea:Ga0059261_0508 Length = 232 Score = 112 bits (280), Expect = 7e-30 Identities = 73/207 (35%), Positives = 105/207 (50%), Gaps = 15/207 (7%) Query: 70 IGKFICIGLNYADHAAESNL-PIPAEPVVFNKWTSAVVGPNDNVKIPRGSKKTDWEVELG 128 + + CIG NYA HA E P P F KW VV + P + +E EL Sbjct: 23 VRRLFCIGRNYAAHAREMGRDPDREPPFFFTKWAETVVPGGTTIAYPPETANFHYEAELV 82 Query: 129 VIIGKGGSYIDEKDAMSHVAGYCVVNDVSEREYQI---ERGGTWDKGKGCDTFGPIGPWL 185 V IG+GG I DA +H+ G+ D++ R+ Q+ E+G WD GK + P+G L Sbjct: 83 VAIGRGGRNIPAADAAAHIYGFATGLDMTRRDLQLVAREQGRPWDTGKNVEQSSPLG--L 140 Query: 186 VTRDEVADPQKLG-MWLEVDGKRYQNGNTSTMIFNVAHIVSYLSRFMSLQPGDVISTGTP 244 + P G + L V+G Q+ + + +I+ V +++Y+SRF L+PGD+I TGTP Sbjct: 141 IHPIAETGPLTGGAIRLTVNGTVKQDADLADLIWPVDEVIAYVSRFYRLEPGDLIYTGTP 200 Query: 245 PGVGMGVKPEAVYLRAGQTIRLGIDGL 271 GVG V+ G I + IDGL Sbjct: 201 AGVGAVVE--------GDRIVVTIDGL 219 Lambda K H 0.316 0.139 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 196 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 232 Length adjustment: 24 Effective length of query: 257 Effective length of database: 208 Effective search space: 53456 Effective search space used: 53456 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory