Align Short-chain dehydrogenase/reductase SDR (characterized, see rationale)
to candidate Ga0059261_2771 Ga0059261_2771 3-hydroxybutyrate dehydrogenase
Query= uniprot:B2T9V3 (247 letters) >FitnessBrowser__Korea:Ga0059261_2771 Length = 261 Score = 140 bits (353), Expect = 3e-38 Identities = 92/258 (35%), Positives = 137/258 (53%), Gaps = 17/258 (6%) Query: 5 LAGKTALITAAGQGIGLATAELFAREGARVIATDIR-----------IDGLAGKPVEARK 53 L+GK+A++T + GIGLA A+ A EGA V+ ++ L+G Sbjct: 3 LSGKSAIVTGSTSGIGLAIAKALAAEGASVMINGFGDAAAIETERAGLEALSGGKALYDG 62 Query: 54 LDVRDDAAIKALA----AEIGAVDVLFNCAGFVHAGNILECSEEDWDFAFDLNVKAMYRM 109 D+ AI A+ AE+G D++ N AG H I + E WD +N+ + + M Sbjct: 63 ADMSKPDAIYAMVERCHAELGGPDIIVNNAGIQHVAAIEDFPPEKWDAIIAINLSSAWHM 122 Query: 110 IRAFLPAMLDKGGGSIINMSSAASSVKGVPNRFAYSASKAAVIGLTKSVAADFITRGVRC 169 +RA +P M G IIN +SA S V PN+ AY A+K + GLTK++A + T GV Sbjct: 123 MRAAVPHMKAAKWGRIINTASAHSLVAS-PNKSAYVAAKHGIAGLTKTIALETATDGVTV 181 Query: 170 NAICPGTVASPSLEQRIVAQAQAQGATLDAV-QAAFVARQPMGRIGKPEEIAALALYLGS 228 N I PG V +P +E +I +A+ T + V +A QP + +PE+IAAL ++L Sbjct: 182 NCISPGYVWTPLVENQIPDTMKARNMTREQVMNDVLLAAQPTKQFVQPEQIAALLVFLCR 241 Query: 229 DESSFTTGHAHVIDGGWS 246 DE+S TG + +DGGW+ Sbjct: 242 DEASAITGANYTMDGGWT 259 Lambda K H 0.320 0.133 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 155 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 261 Length adjustment: 24 Effective length of query: 223 Effective length of database: 237 Effective search space: 52851 Effective search space used: 52851 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory