Align L-fucose-proton symporter; 6-deoxy-L-galactose permease; L-fucose permease (characterized)
to candidate Ga0059261_0767 Ga0059261_0767 glucose/galactose transporter
Query= SwissProt::P11551 (438 letters) >FitnessBrowser__Korea:Ga0059261_0767 Length = 434 Score = 217 bits (553), Expect = 5e-61 Identities = 139/407 (34%), Positives = 218/407 (53%), Gaps = 23/407 (5%) Query: 33 SLFFLWAVANNLNDILLPQFQQAFTLTNFQAGLIQSAFYFGYFIIPIPAGILMKKLSYKA 92 +LFF++ +LND+++P+ ++ FTL QA L+Q F+ Y +I IP L+KKL Y Sbjct: 32 ALFFIFGGITSLNDVIIPKLKELFTLNYTQAMLVQFCFFTAYLVIGIPGAKLVKKLGYMR 91 Query: 93 GIITGLFLYALGAALFWPAAEIMNYTLFLVGLFIIAAGLGCLETAANPFVTVLGPESSGH 152 G + GL +G LF PA++ Y +FL LF++A+G+ ++ ANP +++LG + H Sbjct: 92 GAVAGLLTMMVGCLLFIPASQYATYGVFLFALFVLASGVVIVQVVANPLISLLGKPETAH 151 Query: 153 FRLNLAQTFNSFGAIIAVVFGQSLILSNVPHQSQDVLDKMSPEQLSAYKHSLVLSVQTPY 212 RL AQ FNS G + + G LIL ++ + D++S L AY+ + ++ Y Sbjct: 152 SRLTFAQAFNSLGTTVFPIVGSILILGSL---ATVTADQLSGPALEAYRVAESKAIMHGY 208 Query: 213 MIIVAIVLLVALLIMLTKFPALQSDNHSDAKQGSFSASLSRLARIRHWRWAVLAQFCYVG 272 + I A + +VA ++ L + L+ + H + + A L L R R + + L F YVG Sbjct: 209 LGIAAALAVVAGVVWLFR-NRLKGERH---QASAGLAGLDLLGRPR-FGFGALCIFLYVG 263 Query: 273 AQTACWSYLIRYAV--------EEIPGMTAGFAANYLTGTMVCFFIGRFTGTWLISRFAP 324 A+ + S ++ Y + E+ G GF Y G MV GRF G+ L+ +P Sbjct: 264 AEVSIGSLIVNYLMQPGVMGLQEQAAGKLIGF---YWGGAMV----GRFIGSGLMRVISP 316 Query: 325 HKVLAAYALIAMALCLISAFAGGHVGLIALTLCSAFMSIQYPTIFSLGIKNLGQDTKYGS 384 K+LA A+ A+AL LIS GHV +L SI +PTIFSL + LG GS Sbjct: 317 GKLLAFVAVGAVALILISTNTTGHVAGYSLLAIGLMNSIMFPTIFSLASEKLGGRAADGS 376 Query: 385 SFIVMTIIGGGIVTPVMGFVSDAAGNIPTAELIPALCFAVIFIFARF 431 I + I GG +V G ++DA G++ A ++PA+C+A+I F + Sbjct: 377 GIINIAIFGGAVVPLATGALADATGSLGLALILPAICYAIIAGFGYY 423 Lambda K H 0.329 0.140 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 470 Number of extensions: 25 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 438 Length of database: 434 Length adjustment: 32 Effective length of query: 406 Effective length of database: 402 Effective search space: 163212 Effective search space used: 163212 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory