Align L-fucono-1,5-lactonase; D-arabinolactonase (characterized)
to candidate Ga0059261_2638 Ga0059261_2638 Predicted metal-dependent hydrolase of the TIM-barrel fold
Query= reanno::Smeli:SM_b21101 (278 letters) >FitnessBrowser__Korea:Ga0059261_2638 Length = 303 Score = 124 bits (310), Expect = 3e-33 Identities = 90/296 (30%), Positives = 134/296 (45%), Gaps = 23/296 (7%) Query: 2 IIDTHLHLIDKSALNYPWLAG----------VPALDRDFLYATYAAEAKRVGVAASLHME 51 ++D H+HL D + YPWL G V + D+ Y A+A++ V +H++ Sbjct: 7 LVDPHVHLWDLGHIRYPWLTGPFDTDNPNGSVERIAVDYPLDGYLADAQQWDVRGIVHID 66 Query: 52 VDVDPAEIELETREVARLAGEPGSLLKGAIAACRPEDEGFAAYLERQEENAFVKGFRRVL 111 DPA+ ET+ + +A G + G +A +D L E+A V+G R ++ Sbjct: 67 AGADPADALKETQWLQAMADTRG-MPSGIVAFAALDDPQVETLLSAHVEHANVRGIRHII 125 Query: 112 HVVTD--------DLSEQPLFRENVKRLSGTRFTFDLCVLPHQIPKAIALADLAPDVQFI 163 + D D++ + L +FDL P Q L PD Q I Sbjct: 126 NWHPDPARSYSSADVTTTSAWMRGFGLLKKFGLSFDLQAYPGQFVHLAELIAKHPDTQVI 185 Query: 164 LDHCGVPDIKGHAE--HPWRDHMTEIARHPNVVAKISGVVAYAEEDWALDSIRPYVEHTI 221 L+H G+ I G A+ WR M +A PNV KISG+ + W +D R YV TI Sbjct: 186 LNHTGMA-IPGDADGWETWRRGMAALAALPNVAVKISGM-GFTWRPWDVDQARAYVLETI 243 Query: 222 SVFGWDRVVWGSDWPVCTLGGNLSTWVAATQALIEGCSPQERRKLLSGNAQRIWNL 277 +FG DR ++ S++P L G+ T A A+ +ER L GNA RI+ L Sbjct: 244 ELFGTDRAMFASNFPTDKLFGSFDTHFDAYDAITADFGAEERAALFGGNANRIYRL 299 Lambda K H 0.321 0.137 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 272 Number of extensions: 16 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 278 Length of database: 303 Length adjustment: 26 Effective length of query: 252 Effective length of database: 277 Effective search space: 69804 Effective search space used: 69804 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory