Align Glucose/galactose porter (characterized)
to candidate Ga0059261_2650 Ga0059261_2650 glucose/galactose transporter
Query= TCDB::P0C105 (412 letters) >FitnessBrowser__Korea:Ga0059261_2650 Length = 425 Score = 355 bits (911), Expect = e-102 Identities = 185/407 (45%), Positives = 265/407 (65%), Gaps = 14/407 (3%) Query: 19 KNYGFALTSLTLLFFMWGFITCLNDILIPHLKNVFQLNYTQSMLIQFCFFGAYFIVSLPA 78 ++Y AL L LFFMWGFIT +N+ L+PHL++VF L+YT++ LI+ +F AYF+ S+P+ Sbjct: 17 ESYRRALALLASLFFMWGFITVINNTLLPHLRSVFDLDYTRTTLIESVWFIAYFVASIPS 76 Query: 79 GQLVKRISYKRGIVVGLIVAAIGCALFIPAASYRVYALFLGALFVLASGVTILQVAANPY 138 +L++RI Y+R +V GL+V A G A + AAS Y + L LFV+ASG+T+LQVAANPY Sbjct: 77 ARLIERIGYQRSLVAGLLVMAAGSAGMMLAASIPSYGVTLAMLFVIASGITLLQVAANPY 136 Query: 139 VTILGKPETAASRLTLTQAFNSLGTTVAPVFGAVLIL-----------SAATDATVNAEA 187 V ++G+PETA+SRL L QA NS GT +AP FGA LIL + T A A+A Sbjct: 137 VAVVGRPETASSRLNLVQAMNSAGTMLAPAFGAWLILGRSKGGTSEAGTVLTQAERFADA 196 Query: 188 DAVRFPYLLLALAFTVLAIIFAILKPPDVQEDEPALS--DKKEGSAWQYRHLVLGAIGIF 245 +V PY L+A+A +LA++ A P + L+ +++ S W++R+LV G IF Sbjct: 197 QSVILPYGLVAVALVMLALVIACFPLPAMGAATRRLAKEERRNHSLWKHRNLVFGVPAIF 256 Query: 246 VYVGAEVSVGSFLVNFLSDPTVAGLSETDAAHHVAYFWGGAMVGRFIGSAAMRYIDDGKA 305 +Y+ AE+ V + VNF+S P +A L+ A H++ + WGG M GRF GSA M+ D Sbjct: 257 IYLIAEIGVANLFVNFVSQPDIANLTHEQAGHYLTFLWGGMMAGRFAGSALMQRFDAAHV 316 Query: 306 LAFNAFVAIILLFITVATTGHIAMWSVLAIGLFNSIMFPTIFSLALHGLGSHTSQGSGIL 365 LA A A ++ + TG AMW+++ +G F+SIMFPTIF+L + GLG T +GSG+L Sbjct: 317 LAVFAIGAFAVMLVATFATGPTAMWALILVGFFHSIMFPTIFTLGIRGLGPLTEEGSGLL 376 Query: 366 CLAIVGGAIVPLIQGALADAIGIHLAFLMPIICYAYIAFYGLIGSKS 412 +AI GGA+V ++QG LAD G+ L+FL+ C Y+ FY L GS++ Sbjct: 377 IMAIAGGALV-IVQGWLADQWGLQLSFLLTAACEVYVLFYALWGSRT 422 Lambda K H 0.328 0.141 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 496 Number of extensions: 24 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 412 Length of database: 425 Length adjustment: 32 Effective length of query: 380 Effective length of database: 393 Effective search space: 149340 Effective search space used: 149340 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory