Align ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized)
to candidate Ga0059261_0562 Ga0059261_0562 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component
Query= reanno::pseudo13_GW456_L13:PfGW456L13_1897 (386 letters) >FitnessBrowser__Korea:Ga0059261_0562 Length = 232 Score = 110 bits (276), Expect = 3e-29 Identities = 80/222 (36%), Positives = 115/222 (51%), Gaps = 17/222 (7%) Query: 4 LELRNVNKTYGPGLPDT--LKNIELKIDDGEFLILVGPSGCGKSTLMNCIAGLETISGGA 61 + RNV T G T LK I++ I G + ++GPSG GKS+LM ++GLE SGG Sbjct: 11 IRARNVTLTLGTREAPTEILKGIDVDIARGSSVAILGPSGSGKSSLMAILSGLERASGGE 70 Query: 62 ILV-----DDADISGMSPKDRD-IAMVFQSYALYPTMSVRDNIAFGLKIRKMPTAEIDEE 115 + V D G++ R + +V Q++ L PTM+ +N+A L++ P A Sbjct: 71 VSVAGIAYGTLDEDGLARARRGRVGIVLQAFHLLPTMTAHENVAVPLELAGAPDA----- 125 Query: 116 VARVSKLLQ---IEHLLSRKPGQLSGGQQQRVAMGRALARRPKIYLFDEPLSNLDAKLRV 172 AR L + H L+ P QLSGG+QQRVA+ RA+A RP+I DEP NLD Sbjct: 126 FARAGAELDAVGLGHRLTHYPVQLSGGEQQRVAIARAVAGRPEILFADEPTGNLDGATSG 185 Query: 173 EMRTEMKLMHQRLKTTTVYVTHDQIEAMTLGDKVAVMKDGII 214 + + + T + +THD A D+V M+DG+I Sbjct: 186 AIVDLLFDRQRAADATLLIITHDPALAERC-DRVLTMRDGLI 226 Lambda K H 0.319 0.138 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 237 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 386 Length of database: 232 Length adjustment: 27 Effective length of query: 359 Effective length of database: 205 Effective search space: 73595 Effective search space used: 73595 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory