Align 2-dehydro-3-deoxy-phosphogluconate aldolase (EC 4.1.2.14) (characterized)
to candidate Ga0059261_0356 Ga0059261_0356 Entner-Doudoroff aldolase
Query= BRENDA::Q00384 (208 letters) >FitnessBrowser__Korea:Ga0059261_0356 Length = 202 Score = 230 bits (587), Expect = 1e-65 Identities = 117/201 (58%), Positives = 146/201 (72%), Gaps = 1/201 (0%) Query: 4 IDSVMRLAPVMPVLVIEDIADAKPIAEALVAGGLNVLEVTLRTPCALEAIKIMKEVPGAV 63 I+++MR + V+PVLVIED A A+P+AEALVAGGL VLEVT+RT AL+AI+ MK+VPGA+ Sbjct: 3 IETIMRTSAVIPVLVIEDAATARPLAEALVAGGLKVLEVTMRTAAALDAIREMKQVPGAI 62 Query: 64 VGAGTVLNAKMLDQAQEAGCEFFVSPGLTADLGKHAVAQKAALLPGVANAADVMLGLDLG 123 VGAGTV+N Q +AG EF VSPGLT LG+ V LPGVANA D+M G DLG Sbjct: 63 VGAGTVVNTDQFAQVMDAGAEFIVSPGLTERLGQVIVQSGVPFLPGVANAGDIMRGYDLG 122 Query: 124 LDRFKFFPAENIGGLPALKSMASVFRQVRFCPTGGITPTSAPKYLENPSILCVGGSWVVP 183 L FKFFPAE GGL ALK++A F + +FCPTGGI+P +AP +L +LCVGGSWV P Sbjct: 123 LRHFKFFPAETSGGLKALKALAGPFYEAKFCPTGGISPATAPDWLGFDPVLCVGGSWVTP 182 Query: 184 AGKPDVAKITALAKEASAFKR 204 G A++ ALA++A+ R Sbjct: 183 KG-ASYAEVEALARDAAGLAR 202 Lambda K H 0.320 0.136 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 176 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 208 Length of database: 202 Length adjustment: 21 Effective length of query: 187 Effective length of database: 181 Effective search space: 33847 Effective search space used: 33847 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory