Align L-talarate dehydratase (EC 4.2.1.156); galactarate dehydratase (EC 4.2.1.42) (characterized)
to candidate Ga0059261_2661 Ga0059261_2661 L-alanine-DL-glutamate epimerase and related enzymes of enolase superfamily
Query= BRENDA::Q8ZL58 (398 letters) >FitnessBrowser__Korea:Ga0059261_2661 Length = 383 Score = 125 bits (313), Expect = 3e-33 Identities = 108/349 (30%), Positives = 164/349 (46%), Gaps = 25/349 (7%) Query: 43 PVSDAKVLTGRQKPLTEVAIIIAEIRSRDGFEGVGFSYSKRAGGQGIYAHAKEIADNLLG 102 PV D + + +TEV I++ E + G G+G G + + + G Sbjct: 18 PVGDVNGVV--ESGVTEVPILLLE--TDGGLTGIGL---------GQHVDIARVFPAVEG 64 Query: 103 EDPNDIDKIYTKLLWAGASVGRSGMAVQAISPIDIALWDMKAKRAGLPLAKLLGAHRDSV 162 +DP + +Y +L G +G AI+ ID+ALWD+KAK A PL + LGA V Sbjct: 65 QDPRAVTALYDSMLAHVFKSGHAGATYGAIAAIDMALWDLKAKMADEPLWRTLGALDRFV 124 Query: 163 QCYNTSGGFLHTPLDQVLKNVVISRENGIGGIKLKVGQPNCAEDIRRLTAVREALG---D 219 Y SG P D + G K+K G+ + A DI RL R+ L Sbjct: 125 PGY-ASGLCYGLPDDAFAAHYRDWASRGFSSAKIKGGR-DTARDIGRLLTARDILSVNTS 182 Query: 220 EFPLMVDANQQWDRETAIRMGRKME-QFNLIWIEEPLDAYDIEGHAQLAAALDTPIATGE 278 +M+D N+ W+ + A+R ++E Q +L WIEEP+ +D EGHA+++ A +ATGE Sbjct: 183 RPAMMLDVNEAWNVKQAVRHLAEIEAQLDLTWIEEPVRRWDAEGHARISRACRAAVATGE 242 Query: 279 MLTSFREHEQLILGNASDFVQPDAPRVGGISPFLKIMDLAAKHGRKLAP-HFAMEVHLHL 337 LT + L A D VQ + V GI+ FL++ A ++P + H Sbjct: 243 NLTGLDQFTPLFDARAVDVVQTGS--VWGITHFLRVATAAHARNLPVSPVGYNANPVAHA 300 Query: 338 SAAYPLEPWLEHFEWLNP--LFNEQLELRDGRMWISDRHGLGFTLSEQA 384 +AA P +E +W P L +Q+ + DG + + D GLG + E A Sbjct: 301 AAAMPNMIGIEVQDWNAPRGLKVDQV-VTDGGIRLGDAPGLGIEIDEAA 348 Lambda K H 0.319 0.136 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 398 Number of extensions: 22 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 398 Length of database: 383 Length adjustment: 31 Effective length of query: 367 Effective length of database: 352 Effective search space: 129184 Effective search space used: 129184 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory