Align D-galactarolactone cycloisomerase (EC 5.5.1.27) (characterized)
to candidate Ga0059261_2635 Ga0059261_2635 L-alanine-DL-glutamate epimerase and related enzymes of enolase superfamily
Query= BRENDA::A9CEQ8 (378 letters) >FitnessBrowser__Korea:Ga0059261_2635 Length = 402 Score = 146 bits (368), Expect = 1e-39 Identities = 115/358 (32%), Positives = 174/358 (48%), Gaps = 51/358 (14%) Query: 32 VLVEIECDDGTVGWGECLGPARPNAAVVQAY-SGWLIGQDPRQTEKIWAVLYNALRDQGQ 90 ++VE+E +DGT+G+ G P +V+ + S +LIG+DP E IW +Y + + G+ Sbjct: 65 LVVELEAEDGTIGFAVTTG-GEPACFIVEKHLSRFLIGRDPSDYETIWDQMYFSTQYYGR 123 Query: 91 RGLSLTALSGIDIALWDIKGKHYGASISMLLGGRWRESVRAYATGSFKRDNVDRVSDNAS 150 +GL + A+SG+D+A+WD+ GK + LLGG R+ ++ YATG+ D A Sbjct: 124 KGLVVNAISGVDLAIWDLLGKLRQEPVYHLLGGAVRDEMQFYATGA--------RPDLAK 175 Query: 151 EMAERRAEGFHACKIKIGF-------GVEEDLRVIAAVREAIGPDMRLMIDANHGYTVTE 203 EM GF K+ + G+E+++ ++A +R G D LM D + Sbjct: 176 EM------GFIGGKLPLHHGPAEGEEGMEKNIALLADMRAKCGDDFWLMYDCWMALDIDY 229 Query: 204 AITLGDRAAG-FGIDWFEEPVVPEQLDAYARVRAGQP--IPVAGGETWHGRYGMWQALSA 260 A L RA G+ W EE + P+ YA+++ P + V GE R+G L Sbjct: 230 ATRLAHRAWNECGLKWIEEALSPDDYWGYAQLKKNAPDGLLVTTGEHESTRWGFRMLLEM 289 Query: 261 GAVDILQPDLCGCGGFSEIQKIATLATLHGVRIVPHVWGTGV--------QIAAALQFMA 312 DI+QPD+ CGG +E+ KIA A GV +VPH G+ V + + Sbjct: 290 ECCDIIQPDVGWCGGVTELIKIADDADRKGVLMVPH--GSSVYSYHFVVTRHNSPFAEFL 347 Query: 313 AMTPDPVRVNPIEPIMEFDRTHNPFRQAVLREPLEAVNGVVTIP--DGPGLGIEINRD 368 M P P V P+ F +L EP+ VNG + D PG G+E+NRD Sbjct: 348 MMHPGPTEVVPM------------FAPQLLGEPV-PVNGKIRASELDKPGFGVELNRD 392 Lambda K H 0.321 0.138 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 482 Number of extensions: 32 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 378 Length of database: 402 Length adjustment: 30 Effective length of query: 348 Effective length of database: 372 Effective search space: 129456 Effective search space used: 129456 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory