GapMind for catabolism of small carbon sources

 

Alignments for a candidate for gntEIIA in Sphingomonas koreensis DSMZ 15582

Align PTS system, IIA component, component of The gluconate PTS uptake system. IIAGnt and IIBGnt form a high affinity 2:2 heterotetrameric complex (characterized)
to candidate Ga0059261_0918 Ga0059261_0918 Phosphotransferase system, mannose/fructose-specific component IIA

Query= TCDB::Q82ZC8
         (150 letters)



>FitnessBrowser__Korea:Ga0059261_0918
          Length = 135

 Score = 63.5 bits (153), Expect = 1e-15
 Identities = 33/103 (32%), Positives = 57/103 (55%), Gaps = 6/103 (5%)

Query: 1   MLGIVIATHGALSDGAKDAATVIMGATENIETVNLNSGDDVQALGGQIKTAIENVQQGDG 60
           M+G+V+ THG L++    A   ++G  E I T+++   DD++     I  AI  V  G G
Sbjct: 1   MIGLVLVTHGRLAEEFVVAMEHVVGKQERIATISIGPEDDMEGRRSDIAAAITEVDAGRG 60

Query: 61  VLVMVDLLSASPYNQAVLVINELEPALQKKIFVVSGTNLPMVL 103
           V+V+ DL   +P N A+ ++         ++ V++G NLPM++
Sbjct: 61  VIVLTDLFGGTPSNLAISLME------AGRVEVIAGINLPMLI 97


Lambda     K      H
   0.312    0.130    0.350 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 42
Number of extensions: 3
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 150
Length of database: 135
Length adjustment: 16
Effective length of query: 134
Effective length of database: 119
Effective search space:    15946
Effective search space used:    15946
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 42 (20.8 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory