Align PTS system, IIA component, component of The gluconate PTS uptake system. IIAGnt and IIBGnt form a high affinity 2:2 heterotetrameric complex (characterized)
to candidate Ga0059261_0918 Ga0059261_0918 Phosphotransferase system, mannose/fructose-specific component IIA
Query= TCDB::Q82ZC8 (150 letters) >FitnessBrowser__Korea:Ga0059261_0918 Length = 135 Score = 63.5 bits (153), Expect = 1e-15 Identities = 33/103 (32%), Positives = 57/103 (55%), Gaps = 6/103 (5%) Query: 1 MLGIVIATHGALSDGAKDAATVIMGATENIETVNLNSGDDVQALGGQIKTAIENVQQGDG 60 M+G+V+ THG L++ A ++G E I T+++ DD++ I AI V G G Sbjct: 1 MIGLVLVTHGRLAEEFVVAMEHVVGKQERIATISIGPEDDMEGRRSDIAAAITEVDAGRG 60 Query: 61 VLVMVDLLSASPYNQAVLVINELEPALQKKIFVVSGTNLPMVL 103 V+V+ DL +P N A+ ++ ++ V++G NLPM++ Sbjct: 61 VIVLTDLFGGTPSNLAISLME------AGRVEVIAGINLPMLI 97 Lambda K H 0.312 0.130 0.350 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 42 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 150 Length of database: 135 Length adjustment: 16 Effective length of query: 134 Effective length of database: 119 Effective search space: 15946 Effective search space used: 15946 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 42 (20.8 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory