Align ABC transporter for D-Glucosamine, putative ATPase component (characterized)
to candidate Ga0059261_0341 Ga0059261_0341 ABC-type antimicrobial peptide transport system, ATPase component
Query= reanno::pseudo5_N2C3_1:AO356_00465 (263 letters) >FitnessBrowser__Korea:Ga0059261_0341 Length = 224 Score = 130 bits (328), Expect = 2e-35 Identities = 85/236 (36%), Positives = 135/236 (57%), Gaps = 21/236 (8%) Query: 10 TQPLLDIRGLRKQYGP----LEVLKGVDLSMQRGNVVTLIGSSGSGKTTLLRCVNMLEEF 65 ++P+L GL++ + + VL+G+DL++ +G +V L+G SGSGK+TLL+ V +LE Sbjct: 2 SEPVLQTSGLKRTFSQGGADIHVLRGIDLTVGQGEIVALLGPSGSGKSTLLQAVGLLEGG 61 Query: 66 QGGQIVLDGESIGYDDIDGKRVRHPEKLIARHRAMTGMAFQQFNLFPHLTALQNVTLGLL 125 G I + G +G + + V +KL G +Q +L P AL+NV L L Sbjct: 62 FEGSIRISGVEVGKLESHARTVTRRDKL--------GFVYQFHHLLPDFNALENVELPQL 113 Query: 126 KVKKLPKDEAVALAEKWLERVGLLERRDHFPGQLSGGQQQRVAIARAIAMNPSLMLFDEV 185 ++ +A A +E L +GL R H P QLSGG+QQRVA+ARA+A P+L+L DE Sbjct: 114 -IQNATLADARARSEGLLTALGLGARLTHRPSQLSGGEQQRVAVARALANRPALVLADEP 172 Query: 186 TSALDPE----LVGEVLNVIKGLAEDGMTMLLVTHEMRFAFEVSDKIVFMNQGRIE 237 T LD ++ E L +++G +G L+ TH R A ++ D++V +++G +E Sbjct: 173 TGNLDEHTADIVLAEFLRLVRG---EGAAALIATHNERLAAKM-DRVVRLHEGVLE 224 Lambda K H 0.320 0.138 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 150 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 224 Length adjustment: 23 Effective length of query: 240 Effective length of database: 201 Effective search space: 48240 Effective search space used: 48240 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory