Align N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized)
to candidate Ga0059261_0562 Ga0059261_0562 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component
Query= reanno::Smeli:SMc02869 (352 letters) >FitnessBrowser__Korea:Ga0059261_0562 Length = 232 Score = 118 bits (296), Expect = 1e-31 Identities = 72/205 (35%), Positives = 113/205 (55%), Gaps = 14/205 (6%) Query: 33 EVLKGIDLDVKDGEFVIFVGPSGCGKSTLLRTIAGLEDATSGSVQIDGVEVG-----HVA 87 E+LKGID+D+ G V +GPSG GKS+L+ ++GLE A+ G V + G+ G +A Sbjct: 28 EILKGIDVDIARGSSVAILGPSGSGKSSLMAILSGLERASGGEVSVAGIAYGTLDEDGLA 87 Query: 88 PAKRG-IAMVFQSYALYPHLTVKDNMGLGLKQAGVPKAEIEEKVAKAAGMLSLEPYLARR 146 A+RG + +V Q++ L P +T +N+ + L+ AG P A + + L L Sbjct: 88 RARRGRVGIVLQAFHLLPTMTAHENVAVPLELAGAPDA--FARAGAELDAVGLGHRLTHY 145 Query: 147 PAELSGGQRQRVAIGRAIVREPKLFLFDEPLSNLDAALRVNTRLEIARLHRSLKATMIYV 206 P +LSGG++QRVAI RA+ P++ DEP NLD A + R+ AT++ + Sbjct: 146 PVQLSGGEQQRVAIARAVAGRPEILFADEPTGNLDGATSGAIVDLLFDRQRAADATLLII 205 Query: 207 THDQVEA------MTLADKIVVLNA 225 THD A +T+ D ++V ++ Sbjct: 206 THDPALAERCDRVLTMRDGLIVADS 230 Lambda K H 0.320 0.137 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 191 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 352 Length of database: 232 Length adjustment: 26 Effective length of query: 326 Effective length of database: 206 Effective search space: 67156 Effective search space used: 67156 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory