Align glucokinase (EC 2.7.1.1; EC 2.7.1.2; EC 2.7.1.8) (characterized)
to candidate Ga0059261_0355 Ga0059261_0355 glucokinase, proteobacterial type
Query= ecocyc::GLUCOKIN-MONOMER (321 letters) >FitnessBrowser__Korea:Ga0059261_0355 Length = 323 Score = 160 bits (405), Expect = 4e-44 Identities = 107/314 (34%), Positives = 156/314 (49%), Gaps = 8/314 (2%) Query: 9 DVGGTNARLALCDIASGE---ISQAKTYSGLDYPSLEAVIRVYLEEHKVEV-KDGCIAIA 64 D+GGT+AR A+ ++ G I + T ++ S + + E+ + IAIA Sbjct: 7 DIGGTHARFAIAEVEGGRVVSIGEPVTQKTAEHGSFQLAWQASARALGREMPRAAAIAIA 66 Query: 65 CPITGDWVAMTNHTWAFSIAEMKKNLGFSHLEIINDFTAVSMAIPMLKKEHLIQFGGAEP 124 PI + + +TN+ W +K+ L +INDF AV A+ L EH + G + Sbjct: 67 SPINDELIKLTNNPWIIRPPLIKERLEVDSYSLINDFGAVGHAVAQLPSEHFLHICGPDA 126 Query: 125 --VEGKPIAVYGAGTGLGVAHLVHVDK-RWVSLPGEGGHVDFAPNSEEEAIILEILRAEI 181 E I V G GTGLGVA + + + EGGH+DFAP E I++ LR+ Sbjct: 127 PFAEKGAITVCGPGTGLGVAQVFRTGPLSYHVISTEGGHMDFAPLDGIEDSIVKRLRSTY 186 Query: 182 GHVSAERVLSGPGLVNLYRAIVKADNRLPENLKPKDITERALADSCTDCRRALSLFCVIM 241 VSAER+++GPG+V +Y + + + + L K+I A + AL FC+ + Sbjct: 187 TRVSAERIVAGPGIVPIYETLAEIEGKRTHRLNDKEIWTLAFEGKDSLAMAALDRFCLSL 246 Query: 242 GRFGGNLALNLGTFGGVFIAGGIVPRFLEFFKASGFRAAFEDKGRFKEYVHDIPVYLIVH 301 G G+LAL G GV IAGG+ + + SGF F KGRF+ + IPV LI H Sbjct: 247 GAVAGDLALAHGP-TGVVIAGGLGLKLKDHLVNSGFGQRFIAKGRFQALMSSIPVKLITH 305 Query: 302 DNPGLLGSGAHLRQ 315 PGL G+ A Q Sbjct: 306 PQPGLYGAAAAYAQ 319 Lambda K H 0.322 0.141 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 294 Number of extensions: 16 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 321 Length of database: 323 Length adjustment: 28 Effective length of query: 293 Effective length of database: 295 Effective search space: 86435 Effective search space used: 86435 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory