GapMind for catabolism of small carbon sources

 

Aligments for a candidate for nagEcb in Sphingomonas koreensis DSMZ 15582

Align N-acetylglucosamine-specific PTS system, IIBC components (nagE) (characterized)
to candidate Ga0059261_1647 Ga0059261_1647 PTS system, N-acetylglucosamine-specific IIBC component

Query= reanno::BFirm:BPHYT_RS02745
         (591 letters)



>lcl|FitnessBrowser__Korea:Ga0059261_1647 Ga0059261_1647 PTS system,
           N-acetylglucosamine-specific IIBC component
          Length = 560

 Score =  532 bits (1371), Expect = e-155
 Identities = 297/583 (50%), Positives = 371/583 (63%), Gaps = 59/583 (10%)

Query: 9   IQRLGRALMLPIAVLPVAGLLLRLGQPDVFNIKMIADAGGAIFDNLPLLFAIGVAVGFAK 68
           +Q LGRALMLPIAVLPVAGLLLR+GQPD+ +I  ++ AG AIF NL +LFAIGVAVGFA+
Sbjct: 8   LQPLGRALMLPIAVLPVAGLLLRIGQPDLLDIAFVSAAGTAIFGNLGILFAIGVAVGFAR 67

Query: 69  DNNGVAGLAGAIGYLIE--------------VAVMKDINDKL-----------NMGVLSG 103
           D NG A LAG   YL+               VA + D   K+            + V  G
Sbjct: 68  DGNGAAALAGVTCYLVSTTGAQTFLIAPPEVVAGLPDAAAKVVAQAWATGQIDRLEVPIG 127

Query: 104 IVAGIVAGLLYNRYKDIKLPDYLAFFGGKRFVPIVTGVVCLVLGIAFGYVWQPVQAVIDT 163
           I++G++ G  YNR+  I LP+YLAFFGG+RFVPI  G+  L+L    GY +  + + +D 
Sbjct: 128 IISGLIGGKFYNRFATIALPEYLAFFGGRRFVPIAAGIAGLLLAGVLGYGYAHISSALDA 187

Query: 164 AGHWLTTAGALGAFVFGVLNRLLLVTGLHHILNSLTWFVFGTFTPPGGAAVTGDLHRFFA 223
           A H +  +G  G FV+GVLNRLLLVTGLHH+LN++ WF+ G F   GGA  TGDL RFFA
Sbjct: 188 ASHAVVESGGAGMFVYGVLNRLLLVTGLHHLLNNVAWFLVGDF---GGA--TGDLGRFFA 242

Query: 224 GDPTAGTFMTGFFPVMMFGLPAACLAMFHEAPKERRAVVGGLLFSMALTSFLTGVTEPIE 283
           GDP AG FM+GFFPVMMFGLPAACLAM+HEA  ERR  VGG+LFS+A TSFLTGVTEPIE
Sbjct: 243 GDPNAGAFMSGFFPVMMFGLPAACLAMYHEARPERRKAVGGMLFSLAFTSFLTGVTEPIE 302

Query: 284 FSFMFLAPVLYVIHALLTGISLAICSALGIHLGFTFSAGAIDYVLNYGLSTRGWWAIPIG 343
           F+FMFLAPVLY IHA+LTG+++ +   LGI LGF FSAG  DYVLN+ LSTR W  +P+G
Sbjct: 303 FTFMFLAPVLYAIHAVLTGVAMTLMDMLGIKLGFGFSAGLFDYVLNFKLSTRPWMLLPVG 362

Query: 344 LVYMVVYYGLFRFFIRKFNMATPGREPAAADEQVDSFAAGGFVSPVAGTAVPRAQRYIAA 403
             Y V+YY LFRFFIRK ++ATPGRE   A       AAG            R   ++ A
Sbjct: 363 AAYAVIYYTLFRFFIRKLDLATPGREKGEAVAAAGETAAGN----------ERGAAFVKA 412

Query: 404 LGGASNLSVVDACTTRLRLSVVDSNKVSENELKTIGARGVLKRGSTNVQVIIGPEADIIA 463
           LGGA+NL+ VDACTTRLRL V D + V +  L  +GARG+++  +   QV++GP AD++A
Sbjct: 413 LGGAANLTSVDACTTRLRLIVADQSAVDDAALNALGARGIIRPSANATQVVLGPIADLVA 472

Query: 464 DEIRTVIAQGGGDAVKPAAAAPAQVVAAAPVAASVAQGSGPLDPDPLRWLAVFGGAGNVL 523
           +EIR  I  GGG A    +AAPAQ +A   V              P   LA  GG  N+ 
Sbjct: 473 EEIRGAI--GGGAAA--VSAAPAQALADEAVTL------------PAAILAALGGEANIR 516

Query: 524 SLDAIAATRLRIVVRDPSAVDRQRLATLDTAWISAD--TFHIV 564
           +L A+   R R+ V D +  D   L       +S     +HI+
Sbjct: 517 ALQALHG-RFRVEVVDAARTDEASLLAAANGAVSPQPGVYHIL 558


Lambda     K      H
   0.325    0.141    0.426 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1196
Number of extensions: 68
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 591
Length of database: 560
Length adjustment: 36
Effective length of query: 555
Effective length of database: 524
Effective search space:   290820
Effective search space used:   290820
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory