GapMind for catabolism of small carbon sources

 

Aligments for a candidate for nagEcba in Sphingomonas koreensis DSMZ 15582

Align protein-Npi-phosphohistidine-N-acetyl-D-glucosamine phosphotransferase (EC 2.7.1.193) (characterized)
to candidate Ga0059261_1647 Ga0059261_1647 PTS system, N-acetylglucosamine-specific IIBC component

Query= BRENDA::P45604
         (651 letters)



>lcl|FitnessBrowser__Korea:Ga0059261_1647 Ga0059261_1647 PTS system,
           N-acetylglucosamine-specific IIBC component
          Length = 560

 Score =  441 bits (1135), Expect = e-128
 Identities = 254/564 (45%), Positives = 340/564 (60%), Gaps = 46/564 (8%)

Query: 3   ILGFFQRLGRALQLPIAVLPVAALLLRFGQPDLLNVPFIAQAGGAIFDNLALIFAIGVAS 62
           IL   Q LGRAL LPIAVLPVA LLLR GQPDLL++ F++ AG AIF NL ++FAIGVA 
Sbjct: 4   ILETLQPLGRALMLPIAVLPVAGLLLRIGQPDLLDIAFVSAAGTAIFGNLGILFAIGVAV 63

Query: 63  SWSKDNAGSAALAGAVGYFVMTKAMVTI---NPEINMG---------------------- 97
            +++D  G+AALAG   Y V T    T     PE+  G                      
Sbjct: 64  GFARDGNGAAALAGVTCYLVSTTGAQTFLIAPPEVVAGLPDAAAKVVAQAWATGQIDRLE 123

Query: 98  VLAGIITGLVAGAVYNRWAGIKLPDFLSFFGGKRFVPIATGFFCLILAAIFGYVWPPVQH 157
           V  GII+GL+ G  YNR+A I LP++L+FFGG+RFVPIA G   L+LA + GY +  +  
Sbjct: 124 VPIGIISGLIGGKFYNRFATIALPEYLAFFGGRRFVPIAAGIAGLLLAGVLGYGYAHISS 183

Query: 158 AIHSGGEWIVSAGALGSGIFGFINRLLIPTGLHQVLNTIAWFQIGEFTNAAGTVFHGDIN 217
           A+ +    +V +G  G  ++G +NRLL+ TGLH +LN +AWF +G+F  A G     D+ 
Sbjct: 184 ALDAASHAVVESGGAGMFVYGVLNRLLLVTGLHHLLNNVAWFLVGDFGGATG-----DLG 238

Query: 218 RFYAGDGTAGMFMSGFFPIMMFGLPGAALAMYLAAPKARRPMVGGMLLSVAITAFLTGVT 277
           RF+AGD  AG FMSGFFP+MMFGLP A LAMY  A   RR  VGGML S+A T+FLTGVT
Sbjct: 239 RFFAGDPNAGAFMSGFFPVMMFGLPAACLAMYHEARPERRKAVGGMLFSLAFTSFLTGVT 298

Query: 278 EPLEFLFLFLAPLLYLLHAVLTGISLFIATALGIHAGFSFSAGAIDYVLMYSLPAASKNV 337
           EP+EF F+FLAP+LY +HAVLTG+++ +   LGI  GF FSAG  DYVL + L   S   
Sbjct: 299 EPIEFTFMFLAPVLYAIHAVLTGVAMTLMDMLGIKLGFGFSAGLFDYVLNFKL---STRP 355

Query: 338 WMLLVMGVVFFFVYFLLFSAVIRMFNLKTPGREDKAADVVTEEANSNTEEGLTQLATSYI 397
           WMLL +G  +  +Y+ LF   IR  +L TPGRE   A     E  +  E G      +++
Sbjct: 356 WMLLPVGAAYAVIYYTLFRFFIRKLDLATPGREKGEAVAAAGETAAGNERG-----AAFV 410

Query: 398 AAVGGTDNLKAIDACITRLRLTVGDSAKVNDAACKRLGASGVVKLNKQTIQVIVGAKAES 457
            A+GG  NL ++DAC TRLRL V D + V+DAA   LGA G+++ +    QV++G  A+ 
Sbjct: 411 KALGGAANLTSVDACTTRLRLIVADQSAVDDAALNALGARGIIRPSANATQVVLGPIADL 470

Query: 458 IGDEMKKVVTRGPVAAAAAAPAGNVATAA---PAAKPQAV---ANAKTVESLVSPITGDV 511
           + +E++  +  G  AA +AAPA  +A  A   PAA   A+   AN + +++L      +V
Sbjct: 471 VAEEIRGAI-GGGAAAVSAAPAQALADEAVTLPAAILAALGGEANIRALQALHGRFRVEV 529

Query: 512 VALEQVPDEAFASKAVGDGIAVKP 535
           V   +  DEA    A    ++ +P
Sbjct: 530 VDAART-DEASLLAAANGAVSPQP 552


Lambda     K      H
   0.323    0.138    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 922
Number of extensions: 53
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 651
Length of database: 560
Length adjustment: 37
Effective length of query: 614
Effective length of database: 523
Effective search space:   321122
Effective search space used:   321122
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory