GapMind for catabolism of small carbon sources

 

Aligments for a candidate for MFS-glucose in Sphingomonas koreensis DSMZ 15582

Align The glucose uptake porter, GluP (characterized)
to candidate Ga0059261_1777 Ga0059261_1777 MFS transporter, sugar porter (SP) family

Query= TCDB::Q0SE66
         (483 letters)



>lcl|FitnessBrowser__Korea:Ga0059261_1777 Ga0059261_1777 MFS
           transporter, sugar porter (SP) family
          Length = 458

 Score =  279 bits (713), Expect = 2e-79
 Identities = 171/472 (36%), Positives = 258/472 (54%), Gaps = 25/472 (5%)

Query: 10  AESPGDTAEGTSVPVRIAVVAALGGLLFGYDSAVINGAVSAIEGKFQVDSALLGFAIASA 69
           A +P + A  T   +  A  AALGGLLFG+D+AVI+GA  A++ +F +  A+LGF +ASA
Sbjct: 9   AGAPDEEARATVAIILSAAGAALGGLLFGFDTAVISGATQALQLQFGLTDAMLGFTVASA 68

Query: 70  LLGAAAGAMLAGRIADRYGRLVTMRAAAVMFLLSAIGTGFAANVEMLVTFRIVGGIGVGL 129
           L+G   G+++AG  ADR+GR   M   A+ +++S++GTG A ++   + FR +GG+ +G 
Sbjct: 69  LIGTVLGSLIAGAPADRFGRKGVMLTVAIAYVVSSLGTGLAPDLNAFLVFRFMGGLAIGA 128

Query: 130 ASVIAPAYIAEISPARVRGRLGSLQQLAIVTGIFVSLLVDYALAAIAGGSQEELWFGLEA 189
           ASV+ P YIAE+SPAR RGRL ++ QL IV GI ++ L +Y    IAG  Q ++     A
Sbjct: 129 ASVVTPIYIAEVSPARFRGRLVAMNQLNIVLGILIAFLSNY---IIAGLVQYDV-----A 180

Query: 190 WRWMFLAMCVPALAYGLLSLTIPESPRYLIAQGRLGEARGILAVLLGEKGLDLKIESIRS 249
           WRWMF  + VP+  + L++L +PESPR+L   G+   AR ++  L      D + E  R 
Sbjct: 181 WRWMFGIVAVPSTIFLLVTLLLPESPRWLAIHGQADRARDVMQRL---GFADPRAELARI 237

Query: 250 TLARETQPSIRDLKGSAFGLMPIVWIGIGLSVFQQFVGINVIFYYSSVLWQAVGFDEGSS 309
            LA   + +    +         V   I +++F Q  GIN + YY+  +++  G    S+
Sbjct: 238 ELAEAREEAAGKPRLFQRSHFTPVACAIAIAMFNQLSGINALLYYAPRIFELAGAGADSA 297

Query: 310 LQITVITSVVNIATTLIAIAYIDRVGRRPLLIIGSAGMAVTLATMAFIFGTASTTVVDGV 369
           L  ++     N+  T+ A+  IDR GRRPLL +GS   A TL  + +   +A     DG 
Sbjct: 298 LLQSIAVGGTNLVFTVAALFLIDRFGRRPLLFVGSVICAATLLLVGWQLESAKP---DG- 353

Query: 370 TTPQLTGLQGPIALVAANLFVVAFGMSWGPVVWVLLGEAFPNRIRAAALSLAAGAQWAAN 429
            T  L GL G         F+ AF MS G V+WV + E FP+ +R    +L +   W   
Sbjct: 354 -TLILFGLLG---------FIAAFAMSQGAVIWVFISEVFPSAVRGKGQALGSTTHWVMA 403

Query: 430 WLITVTFPSMKDFSLGISYGFYAVCAVLSLVFVLRWVKETKGVELEAMHSDS 481
             IT  FP       G  + F+    +L L++  +++ ET G+ LE M+  S
Sbjct: 404 AAITWAFPVFAASVGGWVFAFFGAMMLLQLLWTWKFMPETNGIALEDMNLGS 455


Lambda     K      H
   0.324    0.138    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 598
Number of extensions: 29
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 483
Length of database: 458
Length adjustment: 33
Effective length of query: 450
Effective length of database: 425
Effective search space:   191250
Effective search space used:   191250
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory