Align glucokinase (EC 2.7.1.2) (characterized)
to candidate Ga0059261_1776 Ga0059261_1776 Transcriptional regulator/sugar kinase
Query= BRENDA::Q8RDE9 (315 letters) >FitnessBrowser__Korea:Ga0059261_1776 Length = 335 Score = 96.3 bits (238), Expect = 9e-25 Identities = 95/329 (28%), Positives = 142/329 (43%), Gaps = 62/329 (18%) Query: 5 LCGVDLGGTKISTGIVDENGNIIKSIKIPTMAEKGPDVVIERIEESIYQVLKDTGLEMSN 64 L V+ GGTK GI D G+++ +IPT P ++ + + G Sbjct: 19 LGAVEAGGTKFLCGIADRTGSVLAQTRIPTTT---PAETLDAATAFFAEHVARHG----P 71 Query: 65 LKGIGIGSPGPLNAKK-----GIVISPPNLPHWSNVPIVEILSKRLGIEVRLENDANAAA 119 L +GS GPL+ G + S P P W +V ++ + + + L+ D N AA Sbjct: 72 LSAFSVGSFGPLSLDPIAPDYGSITSTPK-PGWQDVDLLGYFRQMIDAPMALDTDVNCAA 130 Query: 120 IGEHLFGSGRGVDNFVYITVSTGIGGGVIIEGKLYSGENSNAAEIGHHTI-------NFD 172 +GE LFGSGRG+D F Y+TV TGIG G+++ G + G +N E GH + +F Sbjct: 131 VGERLFGSGRGLDTFCYVTVGTGIGVGLLVGGAPHGG--ANHPEAGHIRLPRAPGDHDFA 188 Query: 173 GPRCNCGNYG-CFEAYASGTAIARFAREGIEKGIKTKIKELAGEGEVKAEHVFEAAKL-G 230 G C +G C E A G A +KA A L G Sbjct: 189 G---ICPFHGDCLEGLACGPA-------------------------MKARWGAAAETLPG 220 Query: 231 DEFAKELVEKEAFYLGVGIANIMAFYNPRKIAIGGGVSAQWDMLYEKMMETVRKKALKPN 290 D A ++ EA YL A + P +I +GGGV + +++ ++ T+ K + Sbjct: 221 DHPAWDI---EADYLAGLCATLTYIVRPDRIILGGGV-MESHLMHARVRRTLVAKLAGYD 276 Query: 291 AEVCE------VVKAQLGENIGVLGAAAL 313 A + VV G + G+ GA AL Sbjct: 277 ASMRSLDMDEYVVPPTAGPSAGLTGAFAL 305 Lambda K H 0.316 0.138 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 242 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 315 Length of database: 335 Length adjustment: 28 Effective length of query: 287 Effective length of database: 307 Effective search space: 88109 Effective search space used: 88109 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory