Align glucokinase (EC 2.7.1.2) (characterized)
to candidate Ga0059261_4061 Ga0059261_4061 Transcriptional regulator/sugar kinase
Query= BRENDA::B1VZT1 (313 letters) >FitnessBrowser__Korea:Ga0059261_4061 Length = 291 Score = 87.0 bits (214), Expect = 5e-22 Identities = 92/321 (28%), Positives = 135/321 (42%), Gaps = 56/321 (17%) Query: 5 IGVDIGGTKIAAGVVDEEGRILSTFKVATPPTAEGIVDAICAAVAGASEGHDVEAVGIGA 64 + ++ GGTK+ A +V +EG + T P A +A A AG + + VGI A Sbjct: 8 LAIETGGTKLLARLVRDEGVVAEARWPTTSPEA---AEAALLAFAGRTP---LAGVGIAA 61 Query: 65 AG--YVDDKRAT---VLFAPNIDWRHEPLKDKVEQRVGLPVVVENDANAAAWGEYRFGAG 119 G VD A VL P W L+ +EQ +G+PV ++ D NAAA E GAG Sbjct: 62 FGPVVVDPAAANYGEVLATPKPGWTGANLRAALEQALGVPVAIDTDVNAAALAEAAAGAG 121 Query: 120 QGHDDVICITLGTGLGGGIIIGNKLRRGRFGVAAEFGHIRVV-----PDGLLCGCGSQGC 174 QG + +T+GTG+G G+ + G + E GH+ V+ P C S GC Sbjct: 122 QGCSSLAYVTVGTGIGAGLARDGRTLTG--ALHPEMGHVPVLRFEGDPTPSACPFHS-GC 178 Query: 175 WEQYASGRALVRYAKQRANATPENAAVLLGLGDGSVDGIEGKHISEAARQGDPVAVDSFR 234 E A+G A+ R + GK + ++ F Sbjct: 179 AEGMAAGPAVQR-------------------------RLGGKLLEDSPA--------DFA 205 Query: 235 ELARWAGAGLADLASLFDPSAFIVGGGVSDE---GELVLDPIRKSFRRWLIGGEWRPHAQ 291 +A + G A + + P +VGGGV D G+ +R + + +G Sbjct: 206 AVADYLGQLFATIVLAWSPHRIVVGGGVMDVPGLGKAATVRMRVALGGYGVGSAVGEADF 265 Query: 292 VLAAQLGGKAGLVGAADLARQ 312 + +A L AGL GA LARQ Sbjct: 266 IRSAAL-EHAGLEGALILARQ 285 Lambda K H 0.319 0.140 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 296 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 313 Length of database: 291 Length adjustment: 27 Effective length of query: 286 Effective length of database: 264 Effective search space: 75504 Effective search space used: 75504 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory