Align 2-hydroxy-3-oxopropionate reductase (EC 1.1.1.60) (characterized)
to candidate Ga0059261_2836 Ga0059261_2836 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases
Query= BRENDA::Q8ZLV8 (296 letters) >FitnessBrowser__Korea:Ga0059261_2836 Length = 290 Score = 123 bits (308), Expect = 6e-33 Identities = 69/216 (31%), Positives = 115/216 (53%), Gaps = 1/216 (0%) Query: 3 MKVGFIGLGIMGKPMSKNLLKAGYSLVVSDRNPEAIADVIAAGAETASTAKAIAEQCDVI 62 M+VGFIGLG G PM++ ++ AG+ + + R AI +A GA A+ A+A C+++ Sbjct: 1 MRVGFIGLGDQGGPMARMIVDAGFPVTLWARRASAIERFVARGAGVAADPAALASACELV 60 Query: 63 ITMLPNSPHVKEVALGENGIIEGAKPGTVLIDMSSIAPLASREISDALKAKGVEMLDAPV 122 + V+E+ + + G+I + +++ S+I P E++ + A+G +LD PV Sbjct: 61 CLCVTGDADVRELLI-DRGMIAALRKRSLVAIHSTINPKTCVELARMVSARGATLLDMPV 119 Query: 123 SGGEPKAIDGTLSVMVGGDKAIFDKYYDLMKAMAGSVVHTGDIGAGNVTKLANQVIVALN 182 SG A+ L VM GGD + ++++ AG+++ GD+GA KL N ++ +N Sbjct: 120 SGSGHAALARKLLVMTGGDAGAIARTMPVLESYAGTIIRMGDVGAAMNAKLVNNLMAVVN 179 Query: 183 IAAMSEALTLATKAGVNPDLVYQAIRGGLAGSTVLD 218 I AL L K GV P + QA+ G S +D Sbjct: 180 IGQAFHALALGRKVGVEPAALRQALMVGTGRSFAID 215 Lambda K H 0.316 0.132 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 194 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 296 Length of database: 290 Length adjustment: 26 Effective length of query: 270 Effective length of database: 264 Effective search space: 71280 Effective search space used: 71280 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory