Align GluA aka CGL1950, component of Glutamate porter (characterized)
to candidate Ga0059261_0562 Ga0059261_0562 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component
Query= TCDB::P48243 (242 letters) >FitnessBrowser__Korea:Ga0059261_0562 Length = 232 Score = 131 bits (329), Expect = 1e-35 Identities = 83/206 (40%), Positives = 122/206 (59%), Gaps = 9/206 (4%) Query: 17 LTDIDLEIPRGQVVVVLGPSGSGKSTLCRTINRLETIEEGTIEIDG---KVLPEEGKGLA 73 L ID++I RG V +LGPSGSGKS+L ++ LE G + + G L E+G A Sbjct: 30 LKGIDVDIARGSSVAILGPSGSGKSSLMAILSGLERASGGEVSVAGIAYGTLDEDGLARA 89 Query: 74 NLRADVGMVFQSFNLFPHLTIKDNVTLAPIKVRKMKKSEAEKLAMSLLERVGIANQADKY 133 R VG+V Q+F+L P +T +NV + P+++ + A A + L+ VG+ ++ Y Sbjct: 90 R-RGRVGIVLQAFHLLPTMTAHENVAV-PLELAGAPDAFAR--AGAELDAVGLGHRLTHY 145 Query: 134 PAQLSGGQQQRVAIARALAMNPKIMLFDEPTSALDPEMVNEVLDVMASLAKEG-MTMVCV 192 P QLSGG+QQRVAIARA+A P+I+ DEPT LD ++D++ + T++ + Sbjct: 146 PVQLSGGEQQRVAIARAVAGRPEILFADEPTGNLDGATSGAIVDLLFDRQRAADATLLII 205 Query: 193 THEMGFARKAADRVLFMADGLIVEDT 218 TH+ A + DRVL M DGLIV D+ Sbjct: 206 THDPALAER-CDRVLTMRDGLIVADS 230 Lambda K H 0.319 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 163 Number of extensions: 6 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 232 Length adjustment: 23 Effective length of query: 219 Effective length of database: 209 Effective search space: 45771 Effective search space used: 45771 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory