Align (S)-citramalyl-CoA lyase (EC 4.1.3.25) (characterized)
to candidate Ga0059261_0896 Ga0059261_0896 Citrate lyase beta subunit
Query= BRENDA::Q9I562 (275 letters) >FitnessBrowser__Korea:Ga0059261_0896 Length = 272 Score = 115 bits (289), Expect = 8e-31 Identities = 92/270 (34%), Positives = 136/270 (50%), Gaps = 11/270 (4%) Query: 7 RSALFVPATRPERIPKALASGADRVIVDLEDAVEEGLKVEARANLRRFLVDTPEARVLVR 66 R+ALF+PA+ P I KA AD +I+DLEDAV+ G K AR + + +R Sbjct: 10 RTALFLPASNPRAIEKARTLAADMIILDLEDAVKAGDKDAAR-EAAQSAEGFGDRLFGIR 68 Query: 67 INAAEHPGHADDLALCRDHAGVIGLLLPKVESAAQVRHAAVASGKPVWPIVESARGLAAL 126 +NA + +DL R A +++PKVE A + AA S +PV ++E+A G+ Sbjct: 69 VNAEDSAHWIEDLEAVRKSAAT-HVIVPKVEKAETIVRAAFHSERPVLAMIETAAGVMHA 127 Query: 127 GEIAAAAG----VERLSFGSLDLALDLDLNSGSNAAEQILGHARYALLLQTRLAGLAPPL 182 G IA A G + L G+ DLA L L + + L + ++L R A + L Sbjct: 128 GAIAGATGSGVEMAGLIAGTNDLAASLRLPPAAGRTQMQL--SLQLIVLAARAAEIWV-L 184 Query: 183 DGVYPAIQNRAGLVEAVRFARDMGFGGLLCIHPSQVEPIHQTLMPSPAELEWARRVAEAG 242 DGV+ + + GL R +GF G IHP+Q++ + PSPAEL+ AR A Sbjct: 185 DGVFNRLDDGDGLAAEAAEGRLLGFDGKSLIHPNQIDIVRAAFDPSPAELDDAR--ALIA 242 Query: 243 ASGAGVFVVDGEMVDAPVLGRARRLLERAG 272 A+G G M++ + +A+ LL RAG Sbjct: 243 AAGGGAERYKDRMIEDMHVEQAKLLLARAG 272 Lambda K H 0.320 0.137 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 180 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 275 Length of database: 272 Length adjustment: 25 Effective length of query: 250 Effective length of database: 247 Effective search space: 61750 Effective search space used: 61750 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory