Align Tonoplast intrinsic protein-a (transports water, urea, glycerol and gases (CO2 and NH3) (characterized)
to candidate Ga0059261_1307 Ga0059261_1307 MIP family channel proteins
Query= TCDB::Q9XG70 (247 letters) >FitnessBrowser__Korea:Ga0059261_1307 Length = 243 Score = 95.1 bits (235), Expect = 1e-24 Identities = 72/224 (32%), Positives = 109/224 (48%), Gaps = 20/224 (8%) Query: 18 IQALIVEFICTFLFVFAGVGSAMAANKLNGDPLVSLFFVAMAHALVVAVTISAGFRISGG 77 +Q + E + TF VF G GSA+ A + + L V+ A L V + ISG Sbjct: 4 VQRGLAELVGTFWLVFGGCGSAVLAAAFP-EVGIGLLGVSFAFGLTVLTMAYSIGHISGC 62 Query: 78 HLNPAVTLGLCMGGHITVFRSILYWIDQLLASVAACALLNYLTAGLETPVHTLANGVS-- 135 HLNPAVT GL GG LY + Q++ +V A LL + +G + LA G++ Sbjct: 63 HLNPAVTFGLWAGGRFAGKDIPLYVVAQVIGAVIAAWLLYCIASGAPGG-YDLAGGLAAN 121 Query: 136 -YGQ----------GIIMEVILTFSLLFTVYTTIVDPKKGILEGMGPLLTGLVVGANIMA 184 +G+ + +EV+LTF + + + D + G P+ GL + + Sbjct: 122 GFGEHSPGKFNLQSALAIEVVLTFMFVVIIMGS-TDSRAP--AGFAPIAIGLALMLIHLI 178 Query: 185 GGPFSGASMNPARSFGPAFVSGIW--TDHWVYWVGPLIGGGLAG 226 P + S+NPARS GPA + G W + W++WV P++GG L G Sbjct: 179 SIPVTNTSVNPARSTGPALIVGGWAISQLWLFWVAPIVGGVLGG 222 Lambda K H 0.327 0.142 0.443 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 225 Number of extensions: 18 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 243 Length adjustment: 24 Effective length of query: 223 Effective length of database: 219 Effective search space: 48837 Effective search space used: 48837 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory