Align NAD-dependent glycerol dehydrogenase; Dha-forming NAD-dependent glycerol dehydrogenase; EC 1.1.1.6 (characterized)
to candidate Ga0059261_2966 Ga0059261_2966 2-deoxy-D-gluconate 3-dehydrogenase
Query= SwissProt::Q92EU6 (254 letters) >FitnessBrowser__Korea:Ga0059261_2966 Length = 251 Score = 142 bits (359), Expect = 5e-39 Identities = 87/246 (35%), Positives = 136/246 (55%), Gaps = 6/246 (2%) Query: 10 FNITDKVAVVTGAASGIGKAMAELFSEKGAYVVLLD---IKEDVKDVAAQINPSRTLALQ 66 F++T +VAVVTGA +GIG+ +A ++ GA + + E V+ V A + ++ Sbjct: 5 FDLTGRVAVVTGANTGIGQGIALALAQAGADIAAVGRSAATETVEKVRALGRKAEIVS-- 62 Query: 67 VDITKKENIEKVVAEIKKVYPKIDILANSAGVALLEKAEDLPEEYWDKTMELNLKGSFLM 126 D++ E +++VV E + +DIL N+AG+ + + EE WD M+ NLK F + Sbjct: 63 ADLSTIEPVQRVVDETVEKLGGLDILVNNAGIIRRADSVEFTEEDWDAVMDTNLKSVFFL 122 Query: 127 AQIIGREMIATGGGKIVNMASQASVIALDKHVAYCASKAAIVSMTQVLAMEWAPYNINVN 186 Q R MIA GGGKI+N+AS + + +Y ASK+ + +T++LA EWA I VN Sbjct: 123 CQAAARHMIANGGGKIINIASMLTFQGGIRVPSYTASKSGVGGLTKLLANEWASKGITVN 182 Query: 187 AISPTVILTELGKKAWAGQV-GEDMKKLIPAGRFGYPEEVAACALFLVSDAASLITGENL 245 AI+P I T + + + IPAGR+G P ++ A+FL S A+ + G L Sbjct: 183 AIAPGYIATNNTDALQKDETRNRQIMERIPAGRWGDPADLGGAAVFLASRASDYVQGHIL 242 Query: 246 IIDGGY 251 +DGG+ Sbjct: 243 AVDGGW 248 Lambda K H 0.316 0.133 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 162 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 251 Length adjustment: 24 Effective length of query: 230 Effective length of database: 227 Effective search space: 52210 Effective search space used: 52210 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory