Align GlpT, component of Glycerol uptake porter, GlpSTPQV (characterized)
to candidate Ga0059261_3874 Ga0059261_3874 ABC-type antimicrobial peptide transport system, ATPase component
Query= TCDB::G3LHY9 (356 letters) >FitnessBrowser__Korea:Ga0059261_3874 Length = 243 Score = 93.2 bits (230), Expect = 6e-24 Identities = 62/204 (30%), Positives = 107/204 (52%), Gaps = 12/204 (5%) Query: 40 LLGPSGCGKTTLLNIISGLLQPSHGRILFDGKDVTNLSTQSR------NIAQVFQFPVIY 93 ++GPSGCGK+TLL I+SGL P G + G + + +R N VFQ ++ Sbjct: 43 VVGPSGCGKSTLLAILSGLTLPDQGEVDALGNPICRMKAGARDAFRLANTGFVFQGFNLF 102 Query: 94 DTMTVYDNLAFPLRNRGVAEADVDRRVRDILEMIDLASWARRKAQGLTADQKQKISLGRG 153 + +T + +A+ L+ V A+ +R R LE + L R + L+ +KQ++++ R Sbjct: 103 NALTAEEQVAYVLQCMKVKPAEARQRARAALEAVGLGPRMRLRPFELSGGEKQRVAIARA 162 Query: 154 LVRNDVNAILF-DEPLTVIDPHMKWVLRSQLKRLHKQFGFTMVYVTHDQTEALTFAEKVV 212 L + ILF DEP + +D H + + L+ + G ++ VTHD L+FA++++ Sbjct: 163 LAKQP--RILFADEPTSALDSHNGHAVIALLRDIAHNQGAAVLCVTHD-PRLLSFADRII 219 Query: 213 VMYDGQIV--QIGTPAELFERPSH 234 M DG+I+ + P +R +H Sbjct: 220 HMEDGRIIRDERPDPTSAVQRETH 243 Lambda K H 0.321 0.137 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 168 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 356 Length of database: 243 Length adjustment: 26 Effective length of query: 330 Effective length of database: 217 Effective search space: 71610 Effective search space used: 71610 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory