Align ABC transporter for L-Histidine, ATPase component (characterized)
to candidate Ga0059261_1321 Ga0059261_1321 ABC-type antimicrobial peptide transport system, ATPase component
Query= reanno::acidovorax_3H11:Ac3H11_2560 (259 letters) >FitnessBrowser__Korea:Ga0059261_1321 Length = 238 Score = 124 bits (310), Expect = 2e-33 Identities = 74/189 (39%), Positives = 100/189 (52%), Gaps = 9/189 (4%) Query: 22 QALQPVDFEVRDNDFVTILGPSGCGKSTLLRIVAGLDHATSGRVLLDGAPVEGPGAER-- 79 QAL+ VD ++ + DFV ++GPSG GKST + I+ LD TSG L G +E ++ Sbjct: 25 QALKGVDLDIAERDFVAVMGPSGSGKSTTMNILGCLDVPTSGEFLFKGVYIETLDRDQRA 84 Query: 80 -------GMVFQSYTLFPWLTIEQNIRFGLRERGMPEAQQKERAAYFIAKVGLRGFEQHF 132 G VFQ + L +N+ L RG + + E + KVGL + H Sbjct: 85 LVRRKYLGFVFQGFNLLSRTNALENVELPLLYRGEDKKVRHELGMAALEKVGLADWWDHT 144 Query: 133 PKQLSGGMQQRTAIARALANDPKILLMDEPFGALDNQTRVLMQELLLGIWEAERKTVLFV 192 P +LSGG QR AIARA+ P +LL DEP G LD+ V + ELL + + TVL V Sbjct: 145 PAELSGGQPQRVAIARAIVTSPAVLLADEPTGNLDSARSVEIMELLTSLNKDSGITVLMV 204 Query: 193 THDIDEAIF 201 TH+ D A F Sbjct: 205 THEPDMAAF 213 Lambda K H 0.322 0.136 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 119 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 238 Length adjustment: 24 Effective length of query: 235 Effective length of database: 214 Effective search space: 50290 Effective search space used: 50290 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory