Align ABC transporter related (characterized, see rationale)
to candidate Ga0059261_0341 Ga0059261_0341 ABC-type antimicrobial peptide transport system, ATPase component
Query= uniprot:B2TBJ9 (263 letters) >FitnessBrowser__Korea:Ga0059261_0341 Length = 224 Score = 140 bits (354), Expect = 2e-38 Identities = 90/215 (41%), Positives = 128/215 (59%), Gaps = 12/215 (5%) Query: 20 DHHVLKGISLDAHQGDVISILGASGSGKSTFLRCLNLLETPDDGSVSLAGEELKMKRRGD 79 D HVL+GI L QG+++++LG SGSGKST L+ + LLE +GS+ ++G E+ Sbjct: 21 DIHVLRGIDLTVGQGEIVALLGPSGSGKSTLLQAVGLLEGGFEGSIRISGVEV------- 73 Query: 80 GKLQPSDRRQVDRVRSQLGMVFQNFNLWSHMTVLENLIEGPMRVQKRSRAESVEEAEALL 139 GKL+ S R V R R +LG V+Q +L LEN +E P +Q + A++ +E LL Sbjct: 74 GKLE-SHARTVTR-RDKLGFVYQFHHLLPDFNALEN-VELPQLIQNATLADARARSEGLL 130 Query: 140 AKVGLAEKRGHYPAHLSGGQQQRVAIARALAMHPKVMLFDEPTSALDPELVGEVL-RVMR 198 +GL + H P+ LSGG+QQRVA+ARALA P ++L DEPT LD VL +R Sbjct: 131 TALGLGARLTHRPSQLSGGEQQRVAVARALANRPALVLADEPTGNLDEHTADIVLAEFLR 190 Query: 199 SLAEEGRTMLVVTHEMGFARHVSNRVMFLHQGQVE 233 + EG L+ TH A + +RV+ LH+G +E Sbjct: 191 LVRGEGAAALIATHNERLAAKM-DRVVRLHEGVLE 224 Lambda K H 0.318 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 134 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 224 Length adjustment: 23 Effective length of query: 240 Effective length of database: 201 Effective search space: 48240 Effective search space used: 48240 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory