Align Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN (characterized)
to candidate Ga0059261_2137 Ga0059261_2137 ABC-type multidrug transport system, ATPase and permease components
Query= TCDB::Q9HT70 (335 letters) >FitnessBrowser__Korea:Ga0059261_2137 Length = 597 Score = 122 bits (306), Expect = 2e-32 Identities = 79/231 (34%), Positives = 132/231 (57%), Gaps = 19/231 (8%) Query: 2 IEFHDVHKTYRVAGREIPALQPTRLNIQAGQIFGLIGHSGAGKSTLLRLINRLEEPSGGR 61 + F DV T+R G E P + L I+ G+ GL+GHSG+GK+T ++LI RL + + GR Sbjct: 346 VHFDDV--TFRYGGHETPLYEHLTLTIRGGERVGLVGHSGSGKTTFVKLIQRLYDVNEGR 403 Query: 62 ILVEGEDVTALDAEGLRRFRQRVGMIFQHFNLLSSKTVADNIAMPLRLAGGFSRAEVD-- 119 + ++G+DV+ + L R ++ ++ Q +L +++ADNIA G S+AEV+ Sbjct: 404 VTIDGQDVSHATQQSL---RAQIAIV-QQEPILFHRSLADNIAY---ARPGASQAEVEAA 456 Query: 120 ---ARVSELLARV--GLSDHARKYPAQLSGGQKQRVGIARALACRPSILLCDEATSALDP 174 A + + R+ G + + +LSGG++QRV +ARA IL+ DEATS+LD Sbjct: 457 ARLANAHDFIVRLPRGYATLVGERGVKLSGGERQRVALARAFLADAPILILDEATSSLDS 516 Query: 175 QTTASVLQLLAEINRELKLTIVLITHEMDVIRRVCDQVAVMDGGAIVEQGD 225 ++ A + Q + + + T ++I H + +R + D++ V D G I+E GD Sbjct: 517 ESEALIQQAMDRLMK--GRTAIVIAHRLSTVRTL-DRILVFDKGRIIEDGD 564 Lambda K H 0.322 0.138 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 442 Number of extensions: 29 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 335 Length of database: 597 Length adjustment: 32 Effective length of query: 303 Effective length of database: 565 Effective search space: 171195 Effective search space used: 171195 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory