Align BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized)
to candidate Ga0059261_0562 Ga0059261_0562 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component
Query= TCDB::P73721 (252 letters) >FitnessBrowser__Korea:Ga0059261_0562 Length = 232 Score = 124 bits (310), Expect = 2e-33 Identities = 82/206 (39%), Positives = 125/206 (60%), Gaps = 10/206 (4%) Query: 22 QVLRGVTGEIYPKDVISIIGPSGCGKSTFLRCLNRLEPISGGRLEVAGVDLSGAKIDQKH 81 ++L+G+ +I ++I+GPSG GKS+ + L+ LE SGG + VAG+ + +D+ Sbjct: 28 EILKGIDVDIARGSSVAILGPSGSGKSSLMAILSGLERASGGEVSVAGI--AYGTLDEDG 85 Query: 82 L-RQLRVRVGMVFQHFNLFPHLTVLQNLLLAPRKVLRIPMAEAKDRALTYLDKVGLGTKA 140 L R R RVG+V Q F+L P +T +N+ + P ++ P A A RA LD VGLG + Sbjct: 86 LARARRGRVGIVLQAFHLLPTMTAHENVAV-PLELAGAPDAFA--RAGAELDAVGLGHRL 142 Query: 141 DNYPDQLSGGQKQRVAIARGLCMKPEILLFDEPTSALDPELVGEVLNVM--KQLAEEGMT 198 +YP QLSGG++QRVAIAR + +PEIL DEPT LD G +++++ +Q A + T Sbjct: 143 THYPVQLSGGEQQRVAIARAVAGRPEILFADEPTGNLDGATSGAIVDLLFDRQRAADA-T 201 Query: 199 MAVVTHEMQFAREVSNRVFFFNQGII 224 + ++TH+ A E +RV G+I Sbjct: 202 LLIITHDPALA-ERCDRVLTMRDGLI 226 Lambda K H 0.321 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 153 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 252 Length of database: 232 Length adjustment: 23 Effective length of query: 229 Effective length of database: 209 Effective search space: 47861 Effective search space used: 47861 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory