Align N-formylglutamate deformylase (EC 3.5.1.68) (characterized)
to candidate Ga0059261_3962 Ga0059261_3962 N-formylglutamate amidohydrolase
Query= reanno::Korea:Ga0059261_3962 (264 letters) >FitnessBrowser__Korea:Ga0059261_3962 Length = 264 Score = 545 bits (1403), Expect = e-160 Identities = 264/264 (100%), Positives = 264/264 (100%) Query: 1 MIHVEQGSAPLIVSVPHAGTVIPADIQGLVSPELARYDADLYVDHLYAFARGLDATIVRT 60 MIHVEQGSAPLIVSVPHAGTVIPADIQGLVSPELARYDADLYVDHLYAFARGLDATIVRT Sbjct: 1 MIHVEQGSAPLIVSVPHAGTVIPADIQGLVSPELARYDADLYVDHLYAFARGLDATIVRT 60 Query: 61 TVSRTVIDVNRDPSGQTLYPGQFTTGLCPIQTFDGTPLYEPGALPDAHEIERRRAEWFDP 120 TVSRTVIDVNRDPSGQTLYPGQFTTGLCPIQTFDGTPLYEPGALPDAHEIERRRAEWFDP Sbjct: 61 TVSRTVIDVNRDPSGQTLYPGQFTTGLCPIQTFDGTPLYEPGALPDAHEIERRRAEWFDP 120 Query: 121 YHTALAIQIERLRAIHPAIVVYDAHSIRSVVPKLFDGELPNFNIGTNDGTSCAPALTQAV 180 YHTALAIQIERLRAIHPAIVVYDAHSIRSVVPKLFDGELPNFNIGTNDGTSCAPALTQAV Sbjct: 121 YHTALAIQIERLRAIHPAIVVYDAHSIRSVVPKLFDGELPNFNIGTNDGTSCAPALTQAV 180 Query: 181 EAICDASPYSRVTNGRFKGGWITRHYARPAGGVHSIQMELAMRTYLVETPAHWPPPWHEE 240 EAICDASPYSRVTNGRFKGGWITRHYARPAGGVHSIQMELAMRTYLVETPAHWPPPWHEE Sbjct: 181 EAICDASPYSRVTNGRFKGGWITRHYARPAGGVHSIQMELAMRTYLVETPAHWPPPWHEE 240 Query: 241 TAQACQSVLRPILSAAIDFAKAPK 264 TAQACQSVLRPILSAAIDFAKAPK Sbjct: 241 TAQACQSVLRPILSAAIDFAKAPK 264 Lambda K H 0.321 0.136 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 382 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 264 Length of database: 264 Length adjustment: 25 Effective length of query: 239 Effective length of database: 239 Effective search space: 57121 Effective search space used: 57121 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
Align candidate Ga0059261_3962 Ga0059261_3962 (N-formylglutamate amidohydrolase)
to HMM TIGR02017 (hutG: N-formylglutamate deformylase (EC 3.5.1.68))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR02017.hmm # target sequence database: /tmp/gapView.1019.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02017 [M=263] Accession: TIGR02017 Description: hutG_amidohyd: N-formylglutamate deformylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-116 374.1 0.0 2.1e-116 373.9 0.0 1.0 1 lcl|FitnessBrowser__Korea:Ga0059261_3962 Ga0059261_3962 N-formylglutamate Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Korea:Ga0059261_3962 Ga0059261_3962 N-formylglutamate amidohydrolase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 373.9 0.0 2.1e-116 2.1e-116 3 262 .. 2 261 .. 1 262 [. 0.99 Alignments for each domain: == domain 1 score: 373.9 bits; conditional E-value: 2.1e-116 TIGR02017 3 levqrGkaPllislPhtGtdltdavesrlvsaakalkdtdWhieklydfardlGatvvraaisrlvidv 71 ++v++G+aPl++s+Ph+Gt ++ +++ +lvs+ +a+ d+d ++++ly+far l at+vr+++sr+vidv lcl|FitnessBrowser__Korea:Ga0059261_3962 2 IHVEQGSAPLIVSVPHAGTVIPADIQ-GLVSPELARYDADLYVDHLYAFARGLDATIVRTTVSRTVIDV 69 789********************995.8***************************************** PP TIGR02017 72 nrdpsgaslypgqattgliPettfdgeplykdGeaPseaeikkrltkyfkPyhaalraeierlralhgk 140 nrdpsg++lypgq ttgl+P +tfdg+ply+ G P+++ei++r++++f+Pyh+al+ +ierlra+h+ lcl|FitnessBrowser__Korea:Ga0059261_3962 70 NRDPSGQTLYPGQFTTGLCPIQTFDGTPLYEPGALPDAHEIERRRAEWFDPYHTALAIQIERLRAIHPA 138 ********************************************************************* PP TIGR02017 141 ivlydahsirsviPrlfeGklPdfnlGtndgkscdpaladaveavcakakglssvlnGrfkGGyitrhy 209 iv+ydahsirsv+P+lf+G+lP+fn+Gtndg sc+pal++avea+c+ a+ +s+v+nGrfkGG+itrhy lcl|FitnessBrowser__Korea:Ga0059261_3962 139 IVVYDAHSIRSVVPKLFDGELPNFNIGTNDGTSCAPALTQAVEAICD-ASPYSRVTNGRFKGGWITRHY 206 ***********************************************.********************* PP TIGR02017 210 gqPqngvhavqlelaqrgylee..etePvaydeakaealravlkellealldfae 262 ++P+ gvh++q+ela r+yl e +P +++e++a+a + vl+ +l+a++dfa+ lcl|FitnessBrowser__Korea:Ga0059261_3962 207 ARPAGGVHSIQMELAMRTYLVEtpAHWPPPWHEETAQACQSVLRPILSAAIDFAK 261 ********************998889***************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (263 nodes) Target sequences: 1 (264 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.03 # Mc/sec: 1.98 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory