Align NatA aka BRAF aka SLR0467, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate Ga0059261_2542 Ga0059261_2542 ABC-type (unclassified) transport system, ATPase component
Query= TCDB::Q55164 (267 letters) >FitnessBrowser__Korea:Ga0059261_2542 Length = 258 Score = 128 bits (321), Expect = 1e-34 Identities = 80/259 (30%), Positives = 129/259 (49%), Gaps = 15/259 (5%) Query: 8 AENLGSPESSLLLAQGLSKSFGGLRAVDHADIVVKEGSITGLIGPNGAGKTTLFNLLSNF 67 A G+P +S L ++KS+ + + V +G + GL+GPNGAGKTT F + Sbjct: 11 AAEAGTPPTSGLAVVSIAKSYDKRVVLSDVSLSVGKGEVVGLLGPNGAGKTTCFYSVMGL 70 Query: 68 IRPDQGEVLFNGDSIGQLAPHQIALRGSVRTFQVAKVLSRLTVLENMLLADQHQTGEKFL 127 ++PD G ++ +G I L ++ A+ G Q + LTV +N + Sbjct: 71 VKPDAGRIMLDGVDITPLPMYRRAILGLGYLPQETSIFRGLTVAKN-------------I 117 Query: 128 PRLINFRRVQKEERANREKAMAMLESVGLGAKAQDYAGALSGGQRKLLEMARALMSNPKL 187 ++ K RA R + LE GL A ALSGG+R+ E+ARAL ++P + Sbjct: 118 SAVLELSEPDKSARAARLDQL--LEEFGLTRLRDAPAMALSGGERRRAEIARALAADPSI 175 Query: 188 ILLDEPAAGVNPTLIGQICEHIVNWNRQGITFLVIEHNMDVIMTLCHHVWVLAEGRNLAD 247 +LLDEP AG++P I I + + + I L+ +HN+ + + ++ +GR L Sbjct: 176 MLLDEPFAGIDPISIADIRDLVKELKTRNIGVLITDHNVRETLDIVDRASIIYDGRVLFA 235 Query: 248 GTPEQIQSDPRVLEAYLGD 266 G+PE + +D V YLG+ Sbjct: 236 GSPEDLVADANVRRLYLGE 254 Lambda K H 0.319 0.136 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 161 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 258 Length adjustment: 25 Effective length of query: 242 Effective length of database: 233 Effective search space: 56386 Effective search space used: 56386 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory