Align NatA aka BRAF aka SLR0467, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate Ga0059261_4235 Ga0059261_4235 ABC-type multidrug transport system, ATPase component
Query= TCDB::Q55164 (267 letters) >FitnessBrowser__Korea:Ga0059261_4235 Length = 310 Score = 108 bits (269), Expect = 2e-28 Identities = 75/235 (31%), Positives = 115/235 (48%), Gaps = 26/235 (11%) Query: 22 QGLSKSFGGLRAVDHADIVVKEGSITGLIGPNGAGKTTLFNLLSNFIRPDQGEVLFNGDS 81 +GL+K FG VD + V G I G +GPNG+GKTT ++ + PD G G+ Sbjct: 10 EGLTKRFGNRTVVDTVSLEVGRGRICGFLGPNGSGKTTTLRMICGLLIPDGG----GGEV 65 Query: 82 IGQ--LAPHQIALRGSVRTFQVAKVLSRLTVLENM-LLADQHQTGEKFLPRLINFRRVQK 138 +G L ++ R Q + LT+ EN+ +AD + EK Sbjct: 66 LGMDLLTQRELIKRRIGYMTQRFGLFEDLTIRENLAFVADAYGLDEKM------------ 113 Query: 139 EERANREKAMAMLESVGLGAKAQDYAGALSGGQRKLLEMARALMSNPKLILLDEPAAGVN 198 ++ A LE +GL +A AG LSGG ++ L +A ++ +P+++LLDEP AGV+ Sbjct: 114 ------KRVDAALERLGLETRAGQLAGTLSGGWKQRLALAACVLHDPEILLLDEPTAGVD 167 Query: 199 PTLIGQICEHIVNWNRQGITFLVIEHNMDVIMTLCHHVWVLAEGRNLADGTPEQI 253 P + + + + +G T LV H MD CH + +A G LA GT ++I Sbjct: 168 PLARREFWDQVHMLSAEGTTVLVSTHYMDE-AERCHDIAYIAYGVLLARGTADEI 221 Lambda K H 0.319 0.136 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 173 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 310 Length adjustment: 26 Effective length of query: 241 Effective length of database: 284 Effective search space: 68444 Effective search space used: 68444 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory