Align 3-ketoacyl-CoA thiolase (EC 2.3.1.16) (characterized)
to candidate Ga0059261_1483 Ga0059261_1483 acetyl-CoA acetyltransferases
Query= reanno::acidovorax_3H11:Ac3H11_2994 (397 letters) >FitnessBrowser__Korea:Ga0059261_1483 Length = 395 Score = 479 bits (1234), Expect = e-140 Identities = 244/391 (62%), Positives = 295/391 (75%) Query: 7 DPIVIVGAARTPMGSLQGDFSSLAAHDLGGAAIKAAIERAGVSPDAVGEVLFGNCLMAGQ 66 DP+VI+ ARTPMGS+QG S A +LG AA+ AA+ERAG+ +AV + G L AG Sbjct: 4 DPVVIISYARTPMGSMQGVLSDATATELGAAAVGAAVERAGLKGEAVERIYMGCVLPAGL 63 Query: 67 GQAPARQAAFKGGLPKGAGAVTLSKMCGSGMKAAMMAHDMLLAGSHDVMVAGGMESMTNA 126 GQAPARQAA K GLP A T++KMCGSGM+AA+M + L AGS D++VAGG+ESMTNA Sbjct: 64 GQAPARQAARKAGLPDHVEATTVNKMCGSGMQAAIMGAEALAAGSVDLLVAGGLESMTNA 123 Query: 127 PYLLQKGRGGYRLGHDRIFDHMMLDGLEDAYEAGRSMGTFGEDCAAKYSFTREQQDAFAT 186 PYL K R G R+GHDR+FDHM LDGLEDAYE GR+MGTF E+ A +Y FTRE QD FA Sbjct: 124 PYLSMKHRSGARIGHDRLFDHMFLDGLEDAYEPGRAMGTFAEEIATEYQFTREAQDEFAI 183 Query: 187 ASVQRAKAATESGAFAAEIVPVTVKTRAGETVVSVDEGPGKVKLEKIATLKPAFKKDGTI 246 AS+ RA+ A ++G F EI PV +KTR G V DE P K KI TLKPAF KDGTI Sbjct: 184 ASLMRAQKAQQTGGFDREITPVEIKTRKGVVTVDKDEQPAKADPSKIPTLKPAFAKDGTI 243 Query: 247 TAASSSSINDGAAALVMMRESTAKKLGAKPLARIVSHATHAQEPEWFATAPLGATQKALA 306 TAA++SSI+DGAAALV+ R S A++LG P+ARIVSHA HA P F TAP+ A QKAL Sbjct: 244 TAANASSISDGAAALVLTRASVAERLGLDPVARIVSHAAHAHLPARFTTAPVFAMQKALG 303 Query: 307 KAGWQVGDVQLWEINEAFAVVPMALMKELDLPHDKVNVNGGACALGHPIGASGARIMVTL 366 KAGW +GDV L+E+NEAFAVV M M++L + HD +NVNGGACALGHP+GASGARI+ TL Sbjct: 304 KAGWGIGDVDLFEVNEAFAVVAMIAMRDLSISHDVLNVNGGACALGHPVGASGARILATL 363 Query: 367 IHALKARGLTKGLATLCIGGGEATAVALELV 397 + AL+ G +GLA+LCIGGGEATA+A+EL+ Sbjct: 364 LAALQNSGQKRGLASLCIGGGEATAMAVELM 394 Lambda K H 0.317 0.131 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 503 Number of extensions: 22 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 395 Length adjustment: 31 Effective length of query: 366 Effective length of database: 364 Effective search space: 133224 Effective search space used: 133224 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate Ga0059261_1483 Ga0059261_1483 (acetyl-CoA acetyltransferases)
to HMM TIGR01930 (acetyl-CoA C-acyltransferase (EC 2.3.1.16))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01930.hmm # target sequence database: /tmp/gapView.24403.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01930 [M=385] Accession: TIGR01930 Description: AcCoA-C-Actrans: acetyl-CoA C-acyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.9e-129 416.9 10.9 4.4e-129 416.7 10.9 1.0 1 lcl|FitnessBrowser__Korea:Ga0059261_1483 Ga0059261_1483 acetyl-CoA acetyl Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Korea:Ga0059261_1483 Ga0059261_1483 acetyl-CoA acetyltransferases # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 416.7 10.9 4.4e-129 4.4e-129 1 385 [] 8 392 .. 8 392 .. 0.97 Alignments for each domain: == domain 1 score: 416.7 bits; conditional E-value: 4.4e-129 TIGR01930 1 ivdavRtpigklggslkelsaedLlaavikelleragldpekidevilGnvlqageqaniaReaalaag 69 i++++Rtp+g+++g+l++++a +L+aa++ +++eragl+ e+++ +++G+vl+ag ++++aR+aa +ag lcl|FitnessBrowser__Korea:Ga0059261_1483 8 IISYARTPMGSMQGVLSDATATELGAAAVGAAVERAGLKGEAVERIYMGCVLPAGLGQAPARQAARKAG 76 899****************************************************************** PP TIGR01930 70 lpesvpaltvnrvCaSglqAvalaaqkikaGeadvvvaGGvEsmSrvpillkaslrreslklgkakled 138 lp++v+a+tvn++C+Sg+qA +++a++++aG d++vaGG+Esm+++p+l++++ r+++++g+ +l d lcl|FitnessBrowser__Korea:Ga0059261_1483 77 LPDHVEATTVNKMCGSGMQAAIMGAEALAAGSVDLLVAGGLESMTNAPYLSMKH--RSGARIGHDRLFD 143 *************************************************99997..8999********* PP TIGR01930 139 qllkdl....vktklsmgetAenlakkygisReeqDeyalrShqkaakAieegkfkdeivpvevkgk.. 201 ++ d+ + + +mg+ Ae++a++y+++Re qDe+a++S ++a+kA++ g f++ei+pve+k++ lcl|FitnessBrowser__Korea:Ga0059261_1483 144 HMFLDGledaYEPGRAMGTFAEEIATEYQFTREAQDEFAIASLMRAQKAQQTGGFDREITPVEIKTRkg 212 999988999888999**************************************************9998 PP TIGR01930 202 kkvvskDegirpnttlekLakLkpafkekkgstvtAgNssqlnDGAaalllmseevakelgltplariv 270 ++v+kDe++ + k+ +Lkpaf++ +g t+tA+N+s+++DGAaal+l+ +va++lgl+p+ariv lcl|FitnessBrowser__Korea:Ga0059261_1483 213 VVTVDKDEQPA-KADPSKIPTLKPAFAK-DG-TITAANASSISDGAAALVLTRASVAERLGLDPVARIV 278 78888888876.8899**********95.9*.6************************************ PP TIGR01930 271 saavagvdpeemglgpvpAiekaLkkaglsisdidlvEinEAFAaqvlavekelgsldlekvNvnGGAi 339 s+a ++ p++++++pv A++kaL kag+ i d+dl+E+nEAFA+++++++++l ++++ +NvnGGA lcl|FitnessBrowser__Korea:Ga0059261_1483 279 SHAAHAHLPARFTTAPVFAMQKALGKAGWGIGDVDLFEVNEAFAVVAMIAMRDLS-ISHDVLNVNGGAC 346 *******************************************************.779********** PP TIGR01930 340 AlGHPlGasGarivltllkeLkergkkyGlatlCvggGqGaAvile 385 AlGHP+GasGari++tll +L++ g+k+Gla+lC+ggG ++A+ +e lcl|FitnessBrowser__Korea:Ga0059261_1483 347 ALGHPVGASGARILATLLAALQNSGQKRGLASLCIGGGEATAMAVE 392 *******************************************987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (385 nodes) Target sequences: 1 (395 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 12.31 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory