Align 3-ketoacyl-CoA thiolase; Acetyl-CoA acyltransferase; Beta-ketothiolase; EC 2.3.1.16 (characterized)
to candidate Ga0059261_3284 Ga0059261_3284 acetyl-CoA acetyltransferases
Query= SwissProt::O32177 (391 letters) >FitnessBrowser__Korea:Ga0059261_3284 Length = 391 Score = 318 bits (816), Expect = 1e-91 Identities = 176/393 (44%), Positives = 251/393 (63%), Gaps = 6/393 (1%) Query: 1 MKEAVIVSGARTPVGKAKKGSLATVRPDDLGAICVKETLKRAGGYEGNIDDLIIGCATPE 60 M+ AVIVS ARTP+G+A +G+ + L A ++ ++RAG G + D++ G A + Sbjct: 1 MRSAVIVSTARTPIGRAYRGAFNALPAQTLAARSIEAAVQRAGIEGGEVQDVVFGAALQQ 60 Query: 61 AEQGLNMARNIGALAGLPYTVPAITVNRYCSSGLQSIAYAAEKIMLGAYDTAIAGGAESM 120 Q N+AR AGLP +V ++V+R C+SGL +IA AA++I++ D AI GG ES+ Sbjct: 61 GHQAGNIARQAALRAGLPVSVSGMSVDRQCASGLMAIATAAKQIIVDNMDIAIGGGVESI 120 Query: 121 S--QVPMMGHVTRPNLALAEKAPEYYMSMGHTAEQVAKKYGVSREDQDAFAVRSHQNAAK 178 S Q P M P L + YM M TAE VA +Y +SRE QD ++++S Q A Sbjct: 121 SLVQTPQMRIAADPELLAMHN--DVYMPMLQTAEVVAARYNISREVQDEYSLQSQQRTAA 178 Query: 179 ALAEGKFKDEIVPVEVTVTEIGEDHKPM-EKQFVFSQDEGVRPQTTADILSTLRPAFSVD 237 A A GKF DEIVPV T+ + ++ K + +K+ ++DEG RP+TT + L L+P + Sbjct: 179 AQAAGKFDDEIVPVTATMNIVNKETKEVTQKEVTLTKDEGNRPETTLEGLQALQPVVP-N 237 Query: 238 GTVTAGNSSQTSDGAAAVMLMDREKADALGLAPLVKFRSFAVGGVPPEVMGIGPVEAIPR 297 G +TAGN+SQ SDG+++ +LM+ + A+ GL PL ++ AV G P+ MGIGPV AIP Sbjct: 238 GVITAGNASQLSDGSSSSVLMEEKLAEKRGLTPLGRYVGMAVAGTKPDEMGIGPVFAIPA 297 Query: 298 ALKLAGLQLQDIGLFELNEAFASQAIQVIRELGIDEEKVNVNGGAIALGHPLGCTGTKLT 357 L+ L++ DIGL+ELNEAFA Q + +LGI E +NVNGG+I++GHP G TG + T Sbjct: 298 LLERFNLKMDDIGLWELNEAFAVQVLYCRDKLGIPNELLNVNGGSISIGHPYGMTGARCT 357 Query: 358 LSLIHEMKRRNEQFGVVTMCIGGGMGAAGVFEL 390 + E KRR ++ VVTMC+GGGMGAAG+FE+ Sbjct: 358 GHALIEGKRRGAKYVVVTMCVGGGMGAAGLFEV 390 Lambda K H 0.316 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 399 Number of extensions: 12 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 391 Length of database: 391 Length adjustment: 31 Effective length of query: 360 Effective length of database: 360 Effective search space: 129600 Effective search space used: 129600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate Ga0059261_3284 Ga0059261_3284 (acetyl-CoA acetyltransferases)
to HMM TIGR01930 (acetyl-CoA C-acyltransferase (EC 2.3.1.16))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01930.hmm # target sequence database: /tmp/gapView.26218.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01930 [M=385] Accession: TIGR01930 Description: AcCoA-C-Actrans: acetyl-CoA C-acyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.1e-128 413.5 6.4 4.7e-128 413.3 6.4 1.0 1 lcl|FitnessBrowser__Korea:Ga0059261_3284 Ga0059261_3284 acetyl-CoA acetyl Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Korea:Ga0059261_3284 Ga0059261_3284 acetyl-CoA acetyltransferases # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 413.3 6.4 4.7e-128 4.7e-128 1 385 [] 6 389 .. 6 389 .. 0.97 Alignments for each domain: == domain 1 score: 413.3 bits; conditional E-value: 4.7e-128 TIGR01930 1 ivdavRtpig.klggslkelsaedLlaavikelleragldpekidevilGnvlqageq.aniaReaala 67 iv+++Rtpig +++g+++ l+a++L+a i+++++rag++ ++ +v++G++lq+g+q niaR+aal+ lcl|FitnessBrowser__Korea:Ga0059261_3284 6 IVSTARTPIGrAYRGAFNALPAQTLAARSIEAAVQRAGIEGGEVQDVVFGAALQQGHQaGNIARQAALR 74 89*********99*********************************************9********** PP TIGR01930 68 aglpesvpaltvnrvCaSglqAvalaaqkikaGeadvvvaGGvEsmSrvpillkaslrreslklgkakl 136 aglp sv++++v+r+CaSgl A+a+aa++i + ++d+++ GGvEs+S v ++ r ++++ + lcl|FitnessBrowser__Korea:Ga0059261_3284 75 AGLPVSVSGMSVDRQCASGLMAIATAAKQIIVDNMDIAIGGGVESISLVQT--PQ--MRIAADPELLAM 139 ***********************************************9964..33..367888888888 PP TIGR01930 137 edqllkdlvktklsmgetAenlakkygisReeqDeyalrShqkaakAieegkfkdeivpvevkgk.... 201 ++ + ++m +tAe +a++y+isRe qDey+l+S+q++a+A+++gkf+deivpv+ + lcl|FitnessBrowser__Korea:Ga0059261_3284 140 HN-------DVYMPMLQTAEVVAARYNISREVQDEYSLQSQQRTAAAQAAGKFDDEIVPVTATMNivnk 201 88.......6779************************************************99989999 PP TIGR01930 202 ........kkvvskDegirpnttlekLakLkpafkekkgstvtAgNssqlnDGAaalllmseevakelg 262 +++++kDeg rp+ttle L+ L+p+ ++g ++tAgN+sql+DG++ +lm+e+ a++ g lcl|FitnessBrowser__Korea:Ga0059261_3284 202 etkevtqkEVTLTKDEGNRPETTLEGLQALQPVV--PNG-VITAGNASQLSDGSSSSVLMEEKLAEKRG 267 ******99999***********************..489.7**************************** PP TIGR01930 263 ltplarivsaavagvdpeemglgpvpAiekaLkkaglsisdidlvEinEAFAaqvlavekelgsldlek 331 ltpl+r+v++avag +p+emg+gpv Ai+++L++ +l+++di l+E+nEAFA+qvl+++++lg + +e lcl|FitnessBrowser__Korea:Ga0059261_3284 268 LTPLGRYVGMAVAGTKPDEMGIGPVFAIPALLERFNLKMDDIGLWELNEAFAVQVLYCRDKLG-IPNEL 335 ***************************************************************.889** PP TIGR01930 332 vNvnGGAiAlGHPlGasGarivltllkeLkergkkyGlatlCvggGqGaAvile 385 +NvnGG+i++GHP+G++Gar++ + l e k+rg+ky ++t+CvggG+GaA ++e lcl|FitnessBrowser__Korea:Ga0059261_3284 336 LNVNGGSISIGHPYGMTGARCTGHALIEGKRRGAKYVVVTMCVGGGMGAAGLFE 389 **************************************************9986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (385 nodes) Target sequences: 1 (391 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 12.12 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory