Align 3-hydroxyacyl-CoA dehydrogenase IvdG; EC 1.1.1.35 (characterized, see rationale)
to candidate Ga0059261_2801 Ga0059261_2801 Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases)
Query= uniprot:Q8EGC1 (252 letters) >FitnessBrowser__Korea:Ga0059261_2801 Length = 253 Score = 138 bits (348), Expect = 9e-38 Identities = 95/260 (36%), Positives = 148/260 (56%), Gaps = 23/260 (8%) Query: 1 MDLKDKVVVITGGAGGLGLAMAHNFAQAGAKLALIDVDQDKLERACA--DLGSSTEVQGY 58 M+L + ++ITG A G+GLA A A A + L+D +++L+ A A D G + ++ G Sbjct: 1 MNLSGRTILITGAAQGIGLATAQLCAALDANVILLDRSEEQLDAALASFDSGKAMKIAG- 59 Query: 59 ALDITDEEDVVAGFAYILEDFGKINVLVNNAGILRDGMLVKAKDGKVTDRMSFDQFQSVI 118 +TD V A FG I+ LVNNAGI R M+ D+M+ D +Q+VI Sbjct: 60 --SVTDRAFVKQAVAEAAARFGGIHGLVNNAGITRTAMI---------DKMTADDWQAVI 108 Query: 119 NVNLTGTFLCGREAAAAMI---ESGQA--GVIVNISSLA-KAGNVGQSNYAASKAGVAAM 172 +VNLTG F + MI +SG++ G IVNISS A + G +GQ NY A+K+GV + Sbjct: 109 DVNLTGAFNMLQAVGMDMIARAKSGESDPGAIVNISSDAGRKGTIGQINYGAAKSGVLGL 168 Query: 173 SVGWAKELARYNIRSAAVAPGVIATEMTAAMKPEAL-ERLEKLVPVGRLGHAEEIASTVR 231 ++ A+E RY IR+ +VA G++ T+MT ++ E +R +P+GR EE A+++ Sbjct: 169 TMSAAREWGRYGIRTNSVAYGIVETDMTETVRSEKFRDRYLANIPLGRFLTKEEAANSIA 228 Query: 232 FIIE--NDYVNGRVFEVDGG 249 F++ ++ G+ V+GG Sbjct: 229 FLLSPAAAFITGQHLSVNGG 248 Lambda K H 0.317 0.134 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 164 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 252 Length of database: 253 Length adjustment: 24 Effective length of query: 228 Effective length of database: 229 Effective search space: 52212 Effective search space used: 52212 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory