Align 3-hydroxy-2-methylbutyryl-CoA dehydrogenase subunit (EC 1.1.1.178) (characterized)
to candidate Ga0059261_2906 Ga0059261_2906 Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases)
Query= metacyc::MONOMER-11802 (255 letters) >FitnessBrowser__Korea:Ga0059261_2906 Length = 257 Score = 117 bits (293), Expect = 2e-31 Identities = 84/259 (32%), Positives = 130/259 (50%), Gaps = 11/259 (4%) Query: 1 MHIANKHFIVSGAASGLGAATAQMLVEAGAKVMLVDLNAQAVEAKARELGDNARFAV--A 58 M + + I++GAA G+G ATA +L E GA V L+D N + + ++A D R V Sbjct: 5 MSLDGRSVIITGAAQGIGLATAHLLYELGAHVTLLDRNEERL-SEAASAFDAQRILVQCG 63 Query: 59 DISDEQAAQSAVDAAVSAFGSLHGLVNCAGIVGAEKVLGKQGPHGLASFAKVINVNLIGS 118 I+D A+ A ++ FG++ GLVN AGI + L + VI+VNL G Sbjct: 64 SITDRSFVGRAMAAHIARFGAVDGLVNNAGITRTAMIEKMT----LEDWQAVIDVNLTGV 119 Query: 119 FNLLRLAAAAMAEGAADESGERGVIINTASIAAYDGQIGQAAYAASKGAIASLTLPAARE 178 FN+L+ M A + G I+N +S A G IGQ Y A+K + +T+ AARE Sbjct: 120 FNMLQAVGTTMIARAKEGEANPGAIVNISSDAGRKGTIGQINYGAAKSGVLGITMSAARE 179 Query: 179 LARFGIRVMTIAPGIFETPMM-AGMSDEVRASLAAGVPFPPRLGRPQEYAALARHIIE-- 235 R GIRV ++A G+ ET M S++ R + +P R P E A ++ Sbjct: 180 WGRHGIRVNSVAYGVVETEMTEIARSEKFRDRYLSNIPL-GRFLSPDEAAYSIAFLLSPA 238 Query: 236 NSMLNGEVIRLDGALRMAA 254 ++ + G+ + ++G + A Sbjct: 239 SAFITGQHLSVNGGGHITA 257 Lambda K H 0.318 0.131 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 134 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 257 Length adjustment: 24 Effective length of query: 231 Effective length of database: 233 Effective search space: 53823 Effective search space used: 53823 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory