Align galactonate dehydratase (EC 4.2.1.6) (characterized)
to candidate Ga0059261_2635 Ga0059261_2635 L-alanine-DL-glutamate epimerase and related enzymes of enolase superfamily
Query= BRENDA::G3YE52 (383 letters) >FitnessBrowser__Korea:Ga0059261_2635 Length = 402 Score = 91.3 bits (225), Expect = 4e-23 Identities = 84/275 (30%), Positives = 125/275 (45%), Gaps = 22/275 (8%) Query: 17 LFVKIVDEDGQCGWGESTLEGHTEAVEGTLNALCKRFQGYEADDIEHIW-QMAWRLGFYR 75 L V++ EDG G+ +T G A L + G + D E IW QM + +Y Sbjct: 65 LVVELEAEDGTIGFAVTT--GGEPACFIVEKHLSRFLIGRDPSDYETIWDQMYFSTQYYG 122 Query: 76 GGPVFMSAISGIDIALWDLKGRRLGVPIYQLLGGKVRNKLSVYAWIGGDRPSDVE----A 131 + ++AISG+D+A+WDL G+ P+Y LLGG VR+++ YA G RP + Sbjct: 123 RKGLVVNAISGVDLAIWDLLGKLRQEPVYHLLGGAVRDEMQFYA--TGARPDLAKEMGFI 180 Query: 132 AGKARLAQGFKAIKMNATEDINWLDSPRALDSSVERLKTVKALGLDAALDFHGRL-HKPM 190 GK L G + ++I L RA L + LD +D+ RL H+ Sbjct: 181 GGKLPLHHGPAEGEEGMEKNIALLADMRAKCGDDFWLMYDCWMALD--IDYATRLAHRAW 238 Query: 191 AKQLAKALEPHRPLFLEEPLLSEHPEAIKQLSDQV--SCPIALGERLYSRWDVKRFLEDA 248 + K ++EE L + QL + GE +RW + LE Sbjct: 239 NECGLK--------WIEEALSPDDYWGYAQLKKNAPDGLLVTTGEHESTRWGFRMLLEME 290 Query: 249 SVDILQPDIAHCGGISELRRIASMAETYDVAIAPH 283 DI+QPD+ CGG++EL +IA A+ V + PH Sbjct: 291 CCDIIQPDVGWCGGVTELIKIADDADRKGVLMVPH 325 Lambda K H 0.320 0.138 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 446 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 383 Length of database: 402 Length adjustment: 31 Effective length of query: 352 Effective length of database: 371 Effective search space: 130592 Effective search space used: 130592 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory