Align Probable galactose dehydrogenase GalD; EC 1.1.1.- (characterized)
to candidate Ga0059261_2792 Ga0059261_2792 Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases)
Query= SwissProt::Q92RN6 (256 letters) >FitnessBrowser__Korea:Ga0059261_2792 Length = 246 Score = 135 bits (339), Expect = 1e-36 Identities = 86/247 (34%), Positives = 131/247 (53%), Gaps = 10/247 (4%) Query: 11 LRDRGVLVTGGGSGIGAALVEAFARQGARVAFVDIAAESSLALCEKVAAQTGQAPHFIQA 70 L R +L+TG SGIG A E FAR+GA +A +D S L A G A + A Sbjct: 3 LAGRRILITGAASGIGRATAELFAREGAALALLD---RSDDLLRSAAQASGGTA---VLA 56 Query: 71 DLRNVEAVRAAADEAVAKLGSVRVLVNNAARDDRQALEAVTEESWDESLSVNLRHLFFMC 130 DL + + AA +A +G + +VN A Q L+A+ ESWD +++NL + +C Sbjct: 57 DLADEAQLLAAVAKAAQAMGGIDGIVNGAGIAGSQPLDALDRESWDRFVAINLTAPYLIC 116 Query: 131 QAVAPHMQRQGGGSIVNFSS-IAFLLNMPEIPAYSTAKAGIIGLTKSLAGKLGPDNIRVN 189 +A PH+Q G +IVN +S A L N P I AY+ KAG++ TK+L +L P IR N Sbjct: 117 RAALPHLQVTGNATIVNIASGQALLPNAPGIAAYAATKAGLVAFTKALGAELAP-RIRAN 175 Query: 190 AILPGMIVTERQRRL--WLTEESIARMQERQCLKRMLVADDLVGPCLFLASDSSAAMTAQ 247 + PG++ T + + A ++ +KR+ +L LFL+S++S+ +T Sbjct: 176 VVAPGIVDTPMVQGVLGGYARPDDAPFVQQYAMKRVARPSELAEAILFLSSEASSYVTGT 235 Query: 248 AMIIDGG 254 + +DGG Sbjct: 236 VLAVDGG 242 Lambda K H 0.321 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 141 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 256 Length of database: 246 Length adjustment: 24 Effective length of query: 232 Effective length of database: 222 Effective search space: 51504 Effective search space used: 51504 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory