GapMind for catabolism of small carbon sources

 

Aligments for a candidate for lacA' in Sphingomonas koreensis DSMZ 15582

Align lactose 3-dehydrogenase flavin subunit (EC 1.1.99.13) (characterized)
to candidate Ga0059261_0546 Ga0059261_0546 Choline dehydrogenase and related flavoproteins

Query= metacyc::MONOMER-15712
         (579 letters)



>lcl|FitnessBrowser__Korea:Ga0059261_0546 Ga0059261_0546 Choline
           dehydrogenase and related flavoproteins
          Length = 560

 Score =  509 bits (1312), Expect = e-149
 Identities = 274/563 (48%), Positives = 359/563 (63%), Gaps = 16/563 (2%)

Query: 12  NTYDAIVVGSGITGGIAAKELTEKGLKVLVLERGPMVRHLEDYPTAMLDPWQSKYPQGKL 71
           N +DAIV+GSG++GG AAKELTEKGL+VL+L+RG MV H EDY T    P      +  +
Sbjct: 5   NRFDAIVIGSGVSGGFAAKELTEKGLRVLMLDRGVMVEHGEDY-TYDGKPAYEVPARNIM 63

Query: 72  PEAELNAHYKVQRRTGYTMTEQTQHFFVRDDEHPYT--EENRFDWIRGYHVGGRSLTWGR 129
           P+  + + Y + +  GY +    + F+  D  +PY   E ++F WIR   VGG+SL WGR
Sbjct: 64  PKPLIESDYFIAKN-GY-VAPSNRRFYNDDRLNPYAHDEGSKFFWIRPGAVGGKSLIWGR 121

Query: 130 QSYRHSPIDFEANAREGIAVDWPIRYEDLAPWYEHVERFIGVSGQAEGLPHFPDGHYQPP 189
            S+R S  DFEAN REGI  DWPIRY+D+APWY  VE +IGVSG  E LP  PD  +QPP
Sbjct: 122 WSFRWSADDFEANKREGIDGDWPIRYDDIAPWYSKVENYIGVSGSRENLPQLPDSEFQPP 181

Query: 190 MELNCVEKAFKARSEARFPERRVTIGRTAHLTDPTEEQLALGRTKCQYRNLCIRGCPFGA 249
           M +N  EK  K R E +FP R++   R ++LT+   EQ    RTKCQ RN C  GC FGA
Sbjct: 182 MPMNIAEKWVKQRLETQFPGRKLINARLSNLTEDKPEQ---NRTKCQMRNQCGNGCSFGA 238

Query: 250 YYSSNSGGLIAAERTGNLVIRPNSIVTELIYDERAGRASGVRILDAETRKDEEFHADVIF 309
           Y+S+ +  L AA  TG L +R +++VT L YD    R +GVR +DA TR+ E  +AD++F
Sbjct: 239 YFSTQAVTLPAARATGRLTLRSDAVVTNLEYDPVRKRVTGVRFVDARTRQAEVVNADLVF 298

Query: 310 LCASALNSAWIMMNSTSSRFPNGFGNASDQLGRNVMDHHLGAGATGQAPEFADMYFSGRR 369
           LCASA+ S  I+MNS ++       ++S  LG+ VMDH    G  G+ P  ++    GRR
Sbjct: 299 LCASAMASTQILMNSRAAGSGRSHFDSSGTLGKYVMDHIFRVGIEGEIPGMSEYIEYGRR 358

Query: 370 PNGIYVPRFRNLGDAASKRSDYLRGFGYQGGAGRATWERDRGQGGRGFGAARKAALSQPG 429
           P GIY+PRFRN+G  A +   + RG+GYQGGA R            GFGA+ K  + +  
Sbjct: 359 PGGIYIPRFRNIG--ADENLGFKRGYGYQGGAHRDV------APPVGFGASMKHGMRKYA 410

Query: 430 PWTMGLSGFGEMLPYADNRVTLNRDVEDKFGLPTLTMNVTMRDNEMAMRRDMQAAAAEML 489
           PW   +S FGE LPY DN V+L+ D  D+FG+P +  +V  R+NE+ M  D +     ML
Sbjct: 411 PWKFHISAFGECLPYRDNSVSLHADKVDRFGVPLMRFDVRFRENELRMMADARTQGEAML 470

Query: 490 EAAGFQNVRAHDNGFAPGLGIHEMGTARMGRDPKTSVLNAHNQVHECKNVYVTDGAAMAS 549
           +AAG  +VR+ +    PG  IHEMG ARMG DP++SVLN+ +Q H+  N+YVTDGA MAS
Sbjct: 471 KAAGLGSVRSWEGEHVPGDAIHEMGGARMGADPRSSVLNSWSQAHDASNLYVTDGAQMAS 530

Query: 550 ASCVNPSLTYMALTARAADHAVR 572
            SCVNPSLT+MALT RAADHAVR
Sbjct: 531 VSCVNPSLTFMALTVRAADHAVR 553


Lambda     K      H
   0.319    0.135    0.414 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 837
Number of extensions: 36
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 579
Length of database: 560
Length adjustment: 36
Effective length of query: 543
Effective length of database: 524
Effective search space:   284532
Effective search space used:   284532
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory