Align methylglutaconyl-CoA hydratase (EC 4.2.1.18) (characterized)
to candidate Ga0059261_2803 Ga0059261_2803 Enoyl-CoA hydratase/carnithine racemase
Query= BRENDA::Q1D5Y4 (258 letters) >FitnessBrowser__Korea:Ga0059261_2803 Length = 266 Score = 142 bits (357), Expect = 9e-39 Identities = 86/264 (32%), Positives = 134/264 (50%), Gaps = 8/264 (3%) Query: 2 PEFKVDARGPIEIWTIDGESRRNAISRAMLKELGELVTRVSSSRDVRAVVITGAGDKAFC 61 P K + GPI I TID + RNA+S + + L ++ V V++TGAGD FC Sbjct: 4 PVLKAEREGPILILTIDDPATRNALSPELTRALVAACAEANADMSVSCVILTGAGD-VFC 62 Query: 62 AGADLKER-------ATMAEDEVRAFLDGLRRTFRAIEKSDCVFIAAINGAALGGGTELA 114 AG ++K+ A A + R + G++ RA+ + IAA+NGAA+G G + A Sbjct: 63 AGGNIKDMYARANHFAGNAAEIRRTYQAGVQTIARALYDLEVPSIAAVNGAAMGAGMDFA 122 Query: 115 LACDLRVAAPAAELGLTEVKLGIIPGGGGTQRLARLVGPGRAKDLILTARRINAAEAFSV 174 C +R+A+ A+ + +KLG+ GG L R +G A +L LT I+AA A + Sbjct: 123 TMCTMRIASERAKFAESFIKLGLTSAAGGAWFLNRAIGASAAAELALTGDTIDAARALEI 182 Query: 175 GLANRLAPEGHLLAVAYGLAESVVENAPIAVATAKHAIDEGTGLELDDALALELRKYEEI 234 GL + + P LL A LA+ + + ++ + E L+L AL + + Sbjct: 183 GLVSGVVPHAALLDEARALAKRIARHPAHSIRLNTRLLRESARLDLSAALEIASAMQAVV 242 Query: 235 LKTEDRLEGLRAFAEKRAPVYKGR 258 +T+D+ E + A EKR P YKG+ Sbjct: 243 QQTDDQYEAVAAAVEKRPPAYKGK 266 Lambda K H 0.319 0.136 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 157 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 266 Length adjustment: 25 Effective length of query: 233 Effective length of database: 241 Effective search space: 56153 Effective search space used: 56153 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory