Align Putative enoyl-CoA hydratase protein; EC 4.2.1.17 (characterized, see rationale)
to candidate Ga0059261_2858 Ga0059261_2858 Enoyl-CoA hydratase/carnithine racemase
Query= uniprot:Q92VJ6 (261 letters) >FitnessBrowser__Korea:Ga0059261_2858 Length = 260 Score = 99.0 bits (245), Expect = 9e-26 Identities = 79/252 (31%), Positives = 118/252 (46%), Gaps = 4/252 (1%) Query: 11 DQRGVARVTLARSEKHNALSATMIGELTAVVGRLATDASIRAVILDAEGKSFCAGGDLDW 70 +Q GV +TL + NA+S M L + + IRAV+L G +FC+GG L Sbjct: 9 EQDGVVVLTLNVPQLRNAISLEMREALLGHLREAGNNPDIRAVVLTGAGGNFCSGGQLQP 68 Query: 71 MRQQFSADRPTRIAEATRLAMMLKALNDLPKPLIARVHGNAFGGGVGLISVCDTVIAASG 130 + D L +++ L+ PKP IA V G A+G G+ L + CD ++A Sbjct: 69 TNGAAAPDAQRTKRNIAILQDIVRLLSGGPKPTIAAVEGYAYGAGMSLATACDVLVAGES 128 Query: 131 AQFGLTETRLGLI-PATISPYVIARTGEARARPLFMSARVFGAEEAKVAGFVTTVVD-GT 188 A+F + ++GL+ A + + R G RAR + ++ RV A EA G VV G+ Sbjct: 129 ARFCASFGKIGLMADAGMLWSLPQRVGPGRAREMMLTGRVVEAAEAGALGLANRVVPAGS 188 Query: 189 MLDGAVEAAVTAYLVAAPGAAGRAKRLARSLGLPITDAVIAATIEQLADTWETDEAREGV 248 LD A+E A + AP A KR+ + D + A + Q D EG Sbjct: 189 ALDAALEVA-AGFAGIAPLAIAAMKRVMARGPNSLEDVLHAESDAQPVLALSQDYV-EGR 246 Query: 249 SAFFERRNPSWR 260 +AF E+R P +R Sbjct: 247 TAFKEKRAPMFR 258 Lambda K H 0.321 0.133 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 151 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 260 Length adjustment: 25 Effective length of query: 236 Effective length of database: 235 Effective search space: 55460 Effective search space used: 55460 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory