Align methylglutaconyl-CoA hydratase (EC 4.2.1.18) (characterized)
to candidate Ga0059261_2908 Ga0059261_2908 Enoyl-CoA hydratase/carnithine racemase
Query= BRENDA::F4JML5 (301 letters) >FitnessBrowser__Korea:Ga0059261_2908 Length = 275 Score = 130 bits (327), Expect = 3e-35 Identities = 88/258 (34%), Positives = 126/258 (48%), Gaps = 11/258 (4%) Query: 50 GSDSGIIEVNLDRPVTKNAINKEMLKSLQNAFESIHQDNSARVVMIRSLVPGVFCAGADL 109 G + ++ L RP NA++ M +L A ES+ D + R V++ S FCAG DL Sbjct: 16 GRAGAVADIRLRRPFKMNALDGPMFDALIAAAESVAVDPTIRAVVL-SGEGKAFCAGIDL 74 Query: 110 K--------ERRTMSPSEVHTYVNSLRYMFSFIEALSIPTIAAIEGAALGGGLEMALACD 161 + E + S H N + + +P IAA+ G A GGGL++ L D Sbjct: 75 ESLQALMSDEGKQAMQSRSHGLANRYQQAALAWREVPVPVIAALHGVAFGGGLQIPLGAD 134 Query: 162 LRICGENAVFGLPETGLAIIPGAGGTQRLSRLVGRSVSKELIFTGRKIDAIEAANKGLVN 221 +RI + F L E I+P GT L +V V +ELI+T R IEAA+ G+V Sbjct: 135 IRISAPDTKFSLMEVRWGIVPDMAGTVLLRSIVREDVLRELIYTARVFTGIEAASMGIVT 194 Query: 222 ICVTAGEAHEKAIEMAQQINEKGPLAIKMAKKAIDEGIETNMASGLEVEEMCYQKLLNTQ 281 A H A+E+A I E+GP A++ AK+ ++E + L E LL Sbjct: 195 --QLAANPHVAALELASSIAEQGPRAVRAAKQLLNETQSVSPQVALLSESEAQVGLLAGP 252 Query: 282 DRLEGLAAFAEKRKPLYT 299 D++E L A AE+RKP YT Sbjct: 253 DQIEALNAHAEQRKPYYT 270 Lambda K H 0.318 0.134 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 144 Number of extensions: 4 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 301 Length of database: 275 Length adjustment: 26 Effective length of query: 275 Effective length of database: 249 Effective search space: 68475 Effective search space used: 68475 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory